Immunotation of Rv0011C

From DrugPedia: A Wikipedia for Drug discovery

Revision as of 09:57, 19 January 2010 (edit) Shub112004 (Talk | contribs) ← Previous diff		Revision as of 12:36, 28 January 2010 (edit) (undo) Shub112004 (Talk | contribs) (→Protein sequence) Next diff →
Line 12:		Line 12:
	>Rv0011c, TB.seq  13717:13995 MW:10430		>Rv0011c, TB.seq  13717:13995 MW:10430
-	MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH
		+	MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH
	== Human Homologue BLAST result ==		== Human Homologue BLAST result ==

---

Revision as of 12:36, 28 January 2010

Contents 1 Immunotation of Rv0011c (Membrane Protein Mb0011c) UPF 0233 Superfamily 2 General 3 Protein sequence 4 Human Homologue BLAST result 5 Alergen Protein 6 Bacterial Toxin Prediction 7 Subcellular Location

Immunotation of Rv0011c (Membrane Protein Mb0011c) UPF 0233 Superfamily

General

This is a membrane protien for Mycobacterium Tuberclosis. It is responsible for formation of membrane.

Protein sequence

>Rv0011c, TB.seq 13717:13995 MW:10430

MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH

Human Homologue BLAST result

No Human Homologue found.

Alergen Protein

Link to Algpred

The Given Peptide is Not an allergen.

Bacterial Toxin Prediction

Link to btxpred Not a Toxin

Subcellular Location

Link to tbpred