Immunotation of Rv0011C
From DrugPedia: A Wikipedia for Drug discovery
(Difference between revisions)
| (2 intermediate revisions not shown.) | |||
| Line 12: | Line 12: | ||
>Rv0011c, TB.seq 13717:13995 MW:10430 | >Rv0011c, TB.seq 13717:13995 MW:10430 | ||
| - | |||
| + | MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH | ||
== Human Homologue BLAST result == | == Human Homologue BLAST result == | ||
| Line 30: | Line 30: | ||
== Bacterial Toxin Prediction == | == Bacterial Toxin Prediction == | ||
Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred] | Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred] | ||
| - | |||
| - | |||
| + | Not a Toxin | ||
== Subcellular Location == | == Subcellular Location == | ||
Link to [http://www.imtech.res.in/raghava/tbpred/ tbpred] | Link to [http://www.imtech.res.in/raghava/tbpred/ tbpred] | ||
| + | |||
| + | [[Category:C2D]] | ||
| + | [[Category:Mtb Immunotation]] | ||
Current revision
Contents |
[edit] Immunotation of Rv0011c (Membrane Protein Mb0011c) UPF 0233 Superfamily
[edit] General
This is a membrane protien for Mycobacterium Tuberclosis. It is responsible for formation of membrane.
[edit] Protein sequence
>Rv0011c, TB.seq 13717:13995 MW:10430
MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH
[edit] Human Homologue BLAST result
No Human Homologue found.
[edit] Alergen Protein
Link to Algpred
The Given Peptide is Not an allergen.
[edit] Bacterial Toxin Prediction
Link to btxpred
Not a Toxin
[edit] Subcellular Location
Link to tbpred
