. Immunotation of Rv3901c
From DrugPedia: A Wikipedia for Drug discovery
(→General) |
|||
| (One intermediate revision not shown.) | |||
| Line 14: | Line 14: | ||
}} | }} | ||
=General= | =General= | ||
| + | Rv3901c, len: 149. Function: unknown, possible transmembrane stretch from ~30-52. Updated info: Functional Category: cell wall and cell processes. EC: | ||
| + | Functional Annotation: Macromolecule metabolism→ Cell envelope→ Other membrane proteins | ||
==Protein Sequence== | ==Protein Sequence== | ||
| Line 27: | Line 29: | ||
<td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | <td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | ||
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td> sp|Q99607</td><td> 27</td><td> 46</td><td> 69</td><td> 2.5</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|Q9Y2V2</td><td> 29</td><td> 42</td><td> 57</td><td> 4.6</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|P14410</td><td> 41</td><td> 53</td><td> 43</td><td> 5.2</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|P08912</td><td> 38</td><td> 65</td><td> 26</td><td> 5.4</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr></table> | + | <tr><td> sp|Q9Y5Z7</td><td> 30</td><td> 45</td><td> 40</td><td> 6.8</td></tr></table> |
<table border='1'><tr> | <table border='1'><tr> | ||
| - | |||
| - | |||
| - | |||
| - | |||
| - | |||
| - | |||
| - | |||
| - | |||
| - | |||
| - | |||
| - | |||
=Alergen Protein= | =Alergen Protein= | ||
Current revision
| . Immunotation of Rv3901c
| |
| Name | |
| <Rv3901c> Rv3901c membrane protein | |
| Identifiers | |
| Swiss Prot | |
| Genbank | ? |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 15462.2 |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 9.35 |
Contents |
[edit] General
Rv3901c, len: 149. Function: unknown, possible transmembrane stretch from ~30-52. Updated info: Functional Category: cell wall and cell processes. EC: Functional Annotation: Macromolecule metabolism→ Cell envelope→ Other membrane proteins
[edit] Protein Sequence
>Rv3901c, TB.seq 4386365:4386811 MW:15431 VQAANRRSADTICGVTAPAPLPIPRTRSWPAIVVAAIAAVVAVAALIVALTNARPAATPATTSVPTYTAAQTAAAQRQLC DTYKLVAHAVPVDTNGSDKALARITLTNAAAILDNAAADPALDAKHRDAARASDRLPHNDRNGEWWHSS
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q99607 | 27 | 46 | 69 | 2.5 |
| sp|Q9Y2V2 | 29 | 42 | 57 | 4.6 |
| sp|P14410 | 41 | 53 | 43 | 5.2 |
| sp|P08912 | 38 | 65 | 26 | 5.4 |
| sp|Q9Y5Z7 | 30 | 45 | 40 | 6.8 |
