Immunotation of Rv0011C

From DrugPedia: A Wikipedia for Drug discovery

Revision as of 09:16, 19 January 2010 (edit) Shub112004 (Talk | contribs) (New page: Immunotation of Rv0011c (Membrane Protein) General) ← Previous diff		Current revision (18:16, 29 January 2010) (edit) (undo) Raghavagps (Talk | contribs)
(3 intermediate revisions not shown.)
Line 1:		Line 1:
-	Immunotation of Rv0011c (Membrane Protein)	+	== Immunotation of Rv0011c (Membrane Protein Mb0011c) UPF 0233 Superfamily ==
-	General	+
		+
		+
		+
		+	== General ==
		+
		+	This is a membrane protien for Mycobacterium Tuberclosis. It is responsible for formation of membrane.
		+
		+
		+	== Protein sequence ==
		+
		+	>Rv0011c, TB.seq  13717:13995 MW:10430
		+
		+	MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH
		+
		+	== Human Homologue BLAST result ==
		+
		+	No Human Homologue found.
		+
		+
		+
		+	== Alergen Protein ==
		+
		+	Link to [http://www.imtech.res.in/raghava/algpred/  Algpred]
		+
		+	The Given Peptide is Not an allergen.
		+
		+
		+	== Bacterial Toxin Prediction ==
		+	Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]
		+
		+	Not a Toxin
		+
		+	== Subcellular Location ==
		+	Link to [http://www.imtech.res.in/raghava/tbpred/ tbpred]
		+
		+	[[Category:C2D]]
		+	[[Category:Mtb Immunotation]]

---

Current revision

Contents 1 Immunotation of Rv0011c (Membrane Protein Mb0011c) UPF 0233 Superfamily 2 General 3 Protein sequence 4 Human Homologue BLAST result 5 Alergen Protein 6 Bacterial Toxin Prediction 7 Subcellular Location

[edit] Immunotation of Rv0011c (Membrane Protein Mb0011c) UPF 0233 Superfamily

[edit] General

This is a membrane protien for Mycobacterium Tuberclosis. It is responsible for formation of membrane.

[edit] Protein sequence

>Rv0011c, TB.seq 13717:13995 MW:10430

MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH

[edit] Human Homologue BLAST result

No Human Homologue found.

[edit] Alergen Protein

Link to Algpred

The Given Peptide is Not an allergen.

[edit] Bacterial Toxin Prediction

Link to btxpred

Not a Toxin

[edit] Subcellular Location

Link to tbpred