Immunotation of Rv2754c
From DrugPedia: A Wikipedia for Drug discovery
| (One intermediate revision not shown.) | |||
| Line 6: | Line 6: | ||
|Swiss Prot = P66930 | |Swiss Prot = P66930 | ||
| Genbank = 887766 | | Genbank = 887766 | ||
| - | | PDB = | + | | PDB = 2GQ2 |
| DrugBank = | | DrugBank = | ||
| chemical_formula = ? | | chemical_formula = ? | ||
| Line 69: | Line 69: | ||
==B cell Epitopes== | ==B cell Epitopes== | ||
====BCEpred Analysis==== | ====BCEpred Analysis==== | ||
| - | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | + | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred]<br> |
| - | <br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Http_www.imtech.res.in_cg....pdf]<br> |
| - | + | ||
====ABCpred Analysis==== | ====ABCpred Analysis==== | ||
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
| - | Result Predicted By | + | Result Predicted By[http://crdd.osdd.net/drugpedia/images/Abcpred_prediction.pdf]<br> |
====IEDB Analysis==== | ====IEDB Analysis==== | ||
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
| + | Result Predicited by [ ]<br> | ||
| - | + | =MHC Class-I Binder= | |
| - | =MHC Class- | + | ==nHLAPred Analysis== |
| - | == | + | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] |
| - | Link to [http://www.imtech.res.in/raghava/ | + | <br> |
| - | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/A_neural_network_based_MHC_....pdf nHLAPred]<br> | |
| - | + | ||
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| - | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Http_tools.immuneepitope.....pdf IEDB] | |
=MHC Class-II Binder= | =MHC Class-II Binder= | ||
==Propred Analysis== | ==Propred Analysis== | ||
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Prediction_Results.pdf Propred] | ||
==NetMHC-II Analysis== | ==NetMHC-II Analysis== | ||
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| - | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/NetMHCII_2.0_Server_-_predi....pdf] | |
=External Links= | =External Links= | ||
Current revision
| Immunotation of Rv2754c
| |
| Name | |
| Thymidylate synthase thyX | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 32152.9 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 7.02 |
Contents |
[edit] General
flavin dependent thymidylate synthase; ThyX; thymidylate synthase complementing protein; catalyzes the formation of dTMP and tetrahydrofolate from dUMP and methylenetetrahydrofolate; the enzyme from Mycobacterium tuberculosis forms homotetramers; uses FAD as a cofactor
POSSIBLE MOLECULAR FUNTION
1.FAD Binding Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
2.Thymidylate Synthase (FAD) Activity Catalysis of the reaction: 5,10-methylenetetrahydrofolate + dUMP + FADH2 = dTMP + tetrahydrofolate + FAD.
[edit] Protein Sequence
>Rv2754c, TB.seq 3067193:3067942 MW:27560 VAETAPLRVQLIAKTDFLAPPDVPWTTDADGGPALVEFAGRACYQSWSKPNPKTATNAGYLRHIIDVGHFSVLEHASVSF YITGISRSCTHELIRHRHFSYSQLSQRYVPEKDSRVVVPPGMEDDADLRHILTEAADAARATYSELLAKLEAKFADQPNA ILRRKQARQAARAVLPNATETRIVVTGNYRAWRHFIAMRASEHADVEIRRLAIECLRQLAAVAPAVFADFEVTTLADGTE VATSPLATEA
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|O15245| | 29 | 42 | 54 | 0.52 |
| sp|Q5SXH7| | 29 | 40 | 67 | 1.4 |
| sp|O15068| | 28 | 41 | 67 | 2.4 |
| sp|P35520| | 25 | 55 | 47 | 2.6 |
| sp|Q9UI47| | 32 | 52 | 61 | 9.5 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cytoplasmic protein
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [1]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicted By[2]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [ ]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by nHLAPred
[edit] IEDB Analysis
Link to IEDB
Result Predicted by IEDB
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by Propred
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [3]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
