Structural annotation of Rv2753c (dihydrodipicolinate synthase)

From DrugPedia: A Wikipedia for Drug discovery

(Difference between revisions)
Jump to: navigation, search
(PDB Structure)
Current revision (13:25, 30 January 2010) (edit) (undo)
 
(One intermediate revision not shown.)
Line 24: Line 24:
NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
-
=PDB Structure=
+
=Tertiary Structure=
This protein structure is available in PDB and having code [http://www.rcsb.org/pdb/explore/explore.do?structureId=1XXX 1XXX]
This protein structure is available in PDB and having code [http://www.rcsb.org/pdb/explore/explore.do?structureId=1XXX 1XXX]
Detail information available at OCA browser [http://www.ebi.ac.uk/msd-srv/oca/oca-bin/ocashort?id=1XXX 1XXX]
Detail information available at OCA browser [http://www.ebi.ac.uk/msd-srv/oca/oca-bin/ocashort?id=1XXX 1XXX]
-
=Human Homologue Blast Result=
+
Discussion on this protein available at TopSCAN [http://www.topsan.org/Proteins/XMTB/1xxx 1XXX]
-
<table border='1'><tr>
+
==Structure Prediction==
 +
As information is available so we are not applying protein structure prediction method
-
<td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr>
+
= Structure Classification =
 +
Protein: Dihydrodipicolinate synthase from Mycobacterium tuberculosis [http://scop.mrc-lmb.cam.ac.uk/scop/data/scop.b.d.b.bb.b.bc.html SCOP_1XXX]
-
<tr><td>sp|Q9BXD5</td><td> 28</td><td> 46.33</td><td> 300</td><td> 3.00E-023</td></tr>
+
Structural classification of 1XXX as per CATH [http://www.cathdb.info/pdb/1xxx CATH_1XXX]
-
<tr><td>sp|Q86XE5</td><td> 26.57</td><td> 46.15</td><td> 286</td><td> 4.00E-022</td></tr>
+
==Secondray Structure==
 +
Secondary structure of this protein (assigned using DSSP) [ftp://ftp.cmbi.kun.nl/pub/molbio/data/dssp/1xxx.dssp 1XXX.DSSP]
-
<tr><td>sp|Q9UG63</td><td> 26.49</td><td> 37.75</td><td> 151</td><td> 0.45</td></tr>
+
==Secondary Structure Prediction==
 +
We are not applying structure prediction method as structure is available
 +
 
 +
=Related Publications=
 +
Crystal structure and kinetic study of dihydrodipicolinate synthase from Mycobacterium tuberculosis. [http://www.ncbi.nlm.nih.gov/pubmed/18062777?dopt=Abstract Biochem J. 2008 Apr 15;411(2):351-60]
-
<tr><td>sp|O14556</td><td> 22.09</td><td> 50</td><td> 86</td><td> 2</td></tr>
+
Conserved main-chain peptide distortions: a proposed role for Ile203 in catalysis by dihydrodipicolinate synthase. [http://www.ncbi.nlm.nih.gov/pmc/articles/PMC2590918/?tool=pubmed Protein Sci. 2008 Dec;17(12):2080-90. Epub 2008 Sep 11]
-
 
+
-
<tr><td>sp|Q7Z7B0</td><td> 27.69</td><td> 44.62</td><td> 65</td><td> 2.7</td></tr></table>
+
-
=Antigens=
+
-
=External Links=
+
[[Category:C2D]]
[[Category:C2D]]
[[Category:Mtb Station]]
[[Category:Mtb Station]]

Current revision

Structural annotation of Rv2753c (dihydrodipicolinate synthase)
Name
Dihydrodipicolinate Synthase
Identifiers
Swiss Prot P63945
Genbank 888289
PDB 1XXX
Chemical data
Formula  ?
Mol. wt. 30,858 Da
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 5.57

Contents

[edit] General

dapA catalyzes the formation of dihydrodipicolinate from L-aspartate 4-semialdehyde and pyruvate.

L-aspartate 4-semialdehyde + pyruvate = dihydrodipicolinate + 2H2O.

This protein is eesential for optimal growth of M.tb and found in the cytoplasm as predicted by the WoLFPSORT and Subloc Server. HMMpfam found one domain PF00701 and has Helix Turn Helix secondary structure.

[edit] Amino Acid Sequence of Rv2753c

>Rv2753c, TB.seq 3066222:3067121 MW:30827 VTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDR ARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRA LASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKI NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR

[edit] Tertiary Structure

This protein structure is available in PDB and having code 1XXX

Detail information available at OCA browser 1XXX

Discussion on this protein available at TopSCAN 1XXX

[edit] Structure Prediction

As information is available so we are not applying protein structure prediction method

[edit] Structure Classification

Protein: Dihydrodipicolinate synthase from Mycobacterium tuberculosis SCOP_1XXX

Structural classification of 1XXX as per CATH CATH_1XXX

[edit] Secondray Structure

Secondary structure of this protein (assigned using DSSP) 1XXX.DSSP

[edit] Secondary Structure Prediction

We are not applying structure prediction method as structure is available

[edit] Related Publications

Crystal structure and kinetic study of dihydrodipicolinate synthase from Mycobacterium tuberculosis. Biochem J. 2008 Apr 15;411(2):351-60

Conserved main-chain peptide distortions: a proposed role for Ile203 in catalysis by dihydrodipicolinate synthase. Protein Sci. 2008 Dec;17(12):2080-90. Epub 2008 Sep 11