Immunitation of Rv2220
From DrugPedia: A Wikipedia for Drug discovery
(New page: {{immunebox | Name =<b>Glutamine synthetase GLNA1 (glutamine synthase) (GS-I)</b> |image= | width=250 |image2= |Swiss Prot = Q10377 | Genbank = 888383 | PDB = ...) |
(→NetMHC-II Analysis) |
||
(6 intermediate revisions not shown.) | |||
Line 46: | Line 46: | ||
=Alergen Protein= | =Alergen Protein= | ||
Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | ||
- | + | Allergen Predicted by AlgPred Server | |
=Bacterial Toxin Prediction= | =Bacterial Toxin Prediction= | ||
Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br> | Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br> | ||
Line 62: | Line 62: | ||
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | ||
<br> | <br> | ||
- | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/2220.pdf]<br> |
====ABCpred Analysis==== | ====ABCpred Analysis==== | ||
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
- | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/22201.pdf]<br> |
====IEDB Analysis==== | ====IEDB Analysis==== | ||
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
- | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/22202.pdf]<br> |
=MHC Class-I Binder= | =MHC Class-I Binder= | ||
Line 76: | Line 76: | ||
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
<br> | <br> | ||
- | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/22203.pdf]<br> |
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
- | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Pppppppp2.txt] |
=MHC Class-II Binder= | =MHC Class-II Binder= | ||
==Propred Analysis== | ==Propred Analysis== | ||
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
- | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/12122.pdf] |
- | + | ||
==NetMHC-II Analysis== | ==NetMHC-II Analysis== | ||
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
- | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Ptptpt2.pdf] |
=External Links= | =External Links= |
Current revision
Immunitation of Rv2220
| |
Name | |
Glutamine synthetase GLNA1 (glutamine synthase) (GS-I) | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | ? |
Chemical data | |
Formula | ? |
Mol. wt. | 53569.5 |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 4.84 |
Contents |
[edit] General
The gene glnA1 is held cardinal as it codes for the enzyme glutamine synthase which play a vital role in inducing pathogenesis to M.tuberculosis.This enzyme also plays a significant part in nitrogen metabolism.Mycobacterium tuberculosis possess four Glutamine synthetase homologues, two of which, glnA1 and glnA2 are required for virulence and are located on the bacterial chromosome on either side of glutamine synthetase adenylyltransferase (glnE). To assess the role of glutamine synthetase,a glnA1 mutant was constructed via allelic exchange. When complemented by the M. tuberculosis glnA1 gene, the mutant exhibited a wild-type phenotype in broth culture and in human macrophages, and it was virulent in guinea pigs.The major GS(Glutamine synthase) of Mycobacterium tuberculosis is GlnA1, a type I GS whose activity is controlled by posttranscriptional modification by GlnE. Glutamine synthetase catalyzes the ATP-dependent condensation of glutamate and ammonia to form glutamine.Structural basis for the inhibition of Mycobacterium tuberculosis glutamine synthetase IS by the use of novel ATP-competitive inhibitors.Temperature-sensitive mutants of GlnE were generated and shown to have a defect in growth and GS activity in nitrogen-limited medium.Virulence was unaffected in both in vitro and in vivo model systems of infection, indicating that the presence of extra-cellular GS is not critical for virulence and that the residual intra-cellular GS activity is sufficient.
[edit] Protein Sequence
>Rv2220, TB.seq 2487613:2489046 MW:53539 VTEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRGFQSIHESDMLLLPDPETARI DPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLISTGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISG WWNTGAATEADGSPNRGYKVRHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAAD DMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSDTARHYIGGLLHHAPSLLAFT NPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNPKAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAP VDKDLYELPPEEAASIPQTPTQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
[edit] Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|Q5TDP6 | 23 | 40 | 504 | 2e-17 |
sp|P15104 | 25 | 41 | 162 | 7e-04 |
sp|Q15058 | 27 | 38 | 77 | 0.51 |
sp|Q96FW1 | 29 | 48 | 54 | 5.0 |
sp|P56962 | 27 | 46 | 47 | 6.6 |
[edit] Alergen Protein
Link to Algpred
Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cyoplasmic
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [1]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [2]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [3]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [4]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [5]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [6]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [7]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.