Immunotatin of Rv3151
From DrugPedia: A Wikipedia for Drug discovery
(→MHC Class-II Binder) |
|||
(4 intermediate revisions not shown.) | |||
Line 14: | Line 14: | ||
}} | }} | ||
=General= | =General= | ||
- | Inhibiion of apoptosis is | + | Inhibiion of apoptosis is an important event brought about by Mycobacterium Tuberculosis proteins to conquer the surrounding cells.The survival and persistence of Mycobacterium tuberculosis depends on its ability to actively inhibit the death by apoptosis of infected host cells. The genetic basis for this anti-apoptotic activity and its implication for mycobacterial virulence have not been demonstrated or elucidated. Using a novel gain-of-function genetic screen, we demonstrated that inhibition of infection-induced apoptosis of macrophages is controlled by multiple genetic loci in M. tuberculosis. Characterization of one of these loci in detail revealed that the anti-apoptosis activity was attributable to the type I NADH-dehydrogenase of M. tuberculosis, and was mainly due to the subunit of this multicomponent complex encoded by the nuoG gene. Expression of M. tuberculosis nuoG in nonpathogenic mycobacteria endowed them with the ability to inhibit apoptosis of infected human or mouse macrophages, and increased their virulence in a SCID mouse model. Conversely, deletion of nuoG in M. tuberculosis ablated its ability to inhibit macrophage apoptosis and significantly reduced its virulence in mice. These results identify a key component of the genetic basis for an important virulence trait of M. tuberculosis and support a direct causal relationship between virulence of pathogenic mycobacteria and their ability to inhibit macrophage apoptosis. |
==Protein Sequence== | ==Protein Sequence== | ||
Line 30: | Line 30: | ||
KIGAGS | KIGAGS | ||
* | * | ||
- | |||
- | |||
- | |||
=Human Homologue Blast Result= | =Human Homologue Blast Result= | ||
Line 52: | Line 49: | ||
=Alergen Protein= | =Alergen Protein= | ||
Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | ||
- | + | result predicted by[http://crdd.osdd.net/drugpedia/images/Algpred_Out.pdf] | |
=Bacterial Toxin Prediction= | =Bacterial Toxin Prediction= | ||
Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br> | Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br> | ||
Line 68: | Line 65: | ||
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | ||
<br> | <br> | ||
- | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/B1.pdf]<br> |
====ABCpred Analysis==== | ====ABCpred Analysis==== | ||
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
- | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/B2.pdf]<br> |
====IEDB Analysis==== | ====IEDB Analysis==== | ||
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
- | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/B3.pdf]<br> |
=MHC Class-I Binder= | =MHC Class-I Binder= | ||
Line 82: | Line 79: | ||
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
<br> | <br> | ||
- | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Bbb1.pdf]<br> |
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
- | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Beta1.txt] |
=MHC Class-II Binder= | =MHC Class-II Binder= | ||
==Propred Analysis== | ==Propred Analysis== | ||
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
- | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Beta2.pdf] |
==NetMHC-II Analysis== | ==NetMHC-II Analysis== | ||
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
- | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Beta3.txt] |
=External Links= | =External Links= |
Current revision
Immunotatin of Rv3151
| |
Name | |
NADH dehydrogenase subunit G | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | ? |
Chemical data | |
Formula | ? |
Mol. wt. | 85423.2 |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 5.28 |
Contents |
[edit] General
Inhibiion of apoptosis is an important event brought about by Mycobacterium Tuberculosis proteins to conquer the surrounding cells.The survival and persistence of Mycobacterium tuberculosis depends on its ability to actively inhibit the death by apoptosis of infected host cells. The genetic basis for this anti-apoptotic activity and its implication for mycobacterial virulence have not been demonstrated or elucidated. Using a novel gain-of-function genetic screen, we demonstrated that inhibition of infection-induced apoptosis of macrophages is controlled by multiple genetic loci in M. tuberculosis. Characterization of one of these loci in detail revealed that the anti-apoptosis activity was attributable to the type I NADH-dehydrogenase of M. tuberculosis, and was mainly due to the subunit of this multicomponent complex encoded by the nuoG gene. Expression of M. tuberculosis nuoG in nonpathogenic mycobacteria endowed them with the ability to inhibit apoptosis of infected human or mouse macrophages, and increased their virulence in a SCID mouse model. Conversely, deletion of nuoG in M. tuberculosis ablated its ability to inhibit macrophage apoptosis and significantly reduced its virulence in mice. These results identify a key component of the genetic basis for an important virulence trait of M. tuberculosis and support a direct causal relationship between virulence of pathogenic mycobacteria and their ability to inhibit macrophage apoptosis.
[edit] Protein Sequence
>Rv3151, TB.seq 3516743:3519160 MW:85393 VTQAADTDIRVGQPEMVTLTIDGVEISVPKGTLVIRAAELMGIQIPRFCDHPLLEPVGACRQCLVEVEGQRKPLASCTTV ATDDMVVRTQLTSEIADKAQHGVMELLLINHPLDCPMCDKGGECPLQNQAMSNGRTDSRFTEAKRTFAKPINISAQVLLD RERCILCARCTRFSDQIAGDPFIDMQERGALQQVGIYADEPFESYFSGNTVQICPVGALTGTAYRFRARPFDLVSSPSVC EHCASGCAQRTDHRRGKVLRRLAGDDPEVNEEWNCDKGRWAFTYATQPDVITTPLIRDGGDPKGALVPTSWSHAMAVAAQ GLAAARGRTGVLVGGRVTWEDAYAYAKFARITLGTNDIDFRARPHSAEEADFLAARIAGRHMAVSYADLESAPVVLLVGF EPEDESPIVFLRLRKAARRHRVPVYTIAPFATGGLHKMSGRLIKTVPGGEPAALDDLATGAVGDLLATPGAVIIVGERLA TVPGGLSAAARLADTTGARLAWVPRRAGERGALEAGALPTLLPGGRPLADEVARAQVCAAWHIAELPAAAGRDADGILAA AADETLAALLVGGIEPADFADPDAVLAALDATGFVVSLELRHSTVTERADVVFPVAPTTQKAGAFVNWEGRYRTFEPALR GSTLQAGQSDHRVLDALADDMGVHLGVPTVEAAREELAALGIWDGKHAAGPHIAATGPTQPEAGEAILTGWRMLLDEGRL QDGEPYLAGTARTPVVRLSPDTAAEIGAADGEAVTVSTSRGSITLPCSVTDMPDRVVWLPLNSAGSTVHRQLRVTIGSIV KIGAGS
[edit] Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|P28331 | 31 | 46 | 683 | 1e-67 |
sp|Q96RG2 | 27 | 40 | 140 | 1.7 |
sp|Q9UFP1 | 28 | 43 | 78 | 4.2 |
sp|Q9UPY6 | 38 | 52 | 36 | 4.9 |
p|Q2M3C7 | 51 | 72 | 29 | 6.2 |
[edit] Alergen Protein
Link to Algpred
result predicted by[1]
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cyoplasmic
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.