Immunotation of Rv0011C

From DrugPedia: A Wikipedia for Drug discovery

Revision as of 12:37, 28 January 2010 (edit) Shub112004 (Talk | contribs) (→Bacterial Toxin Prediction) ← Previous diff		Current revision (18:16, 29 January 2010) (edit) (undo) Raghavagps (Talk | contribs)
Line 35:		Line 35:
	== Subcellular Location ==		== Subcellular Location ==
	Link to [http://www.imtech.res.in/raghava/tbpred/ tbpred]		Link to [http://www.imtech.res.in/raghava/tbpred/ tbpred]
		+
		+	[[Category:C2D]]
		+	[[Category:Mtb Immunotation]]

---

Current revision

Contents 1 Immunotation of Rv0011c (Membrane Protein Mb0011c) UPF 0233 Superfamily 2 General 3 Protein sequence 4 Human Homologue BLAST result 5 Alergen Protein 6 Bacterial Toxin Prediction 7 Subcellular Location

[edit] Immunotation of Rv0011c (Membrane Protein Mb0011c) UPF 0233 Superfamily

[edit] General

This is a membrane protien for Mycobacterium Tuberclosis. It is responsible for formation of membrane.

[edit] Protein sequence

>Rv0011c, TB.seq 13717:13995 MW:10430

MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH

[edit] Human Homologue BLAST result

No Human Homologue found.

[edit] Alergen Protein

Link to Algpred

The Given Peptide is Not an allergen.

[edit] Bacterial Toxin Prediction

Link to btxpred

Not a Toxin

[edit] Subcellular Location

Link to tbpred