From DrugPedia: A Wikipedia for Drug discovery

Revision as of 19:46, 25 April 2010 (edit) Nitinkumar (Talk | contribs) (New page: {{immunebox | Name =<b>proteasome (alpha subunit) PrcA </b> |image= | width=250 |image2= |Swiss Prot = O33244 | Genbank = 887538 | PDB = 3H6I | DrugBank ...) ← Previous diff

Current revision (19:46, 25 April 2010) (edit) (undo) Nitinkumar (Talk | contribs) (New page: {{immunebox | Name =<b>proteasome (alpha subunit) PrcA </b> |image= | width=250 |image2= |Swiss Prot = O33244 | Genbank = 887538 | PDB = 3H6I | DrugBank ...)

---

Current revision

Rv2109c
Name
proteasome (alpha subunit) PrcA
Identifiers
Swiss Prot	O33244
Genbank	887538
PDB	3H6I
Chemical data
Formula	C15H14N6S [1]
Mol. wt.	26848.9 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	5.1885

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

Other PDB: 3HFA 3H6F 3HF9 2FHH 2FHG Involved in protein degradation.

The product of this CDS corresponds to spot 2109c identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Proteasome encoded by prcBA genes is essential for persistence and optimal growth in mice; Silencing of prcBA results in increased susceptibility to reactive nitrogen intermediates stress and increased resistance to oxidative stress (See Gandotra et al., 2007). mutants available at TARGET website

[edit] Protein Sequence

>Rv2109c, TB.seq 2368984:2369727 MW:26850 VSFPYFISPEQAMRERSELARKGIARAKSVVALAYAGGVLFVAENPSRSLQKISELYDRVGFAAAGKFNEFDNLRRGGIQ FADTRGYAYDRRDVTGRQLANVYAQTLGTIFTEQAKPYEVELCVAEVAHYGETKRPELYRITYDGSIADEPHFVVMGGTT EPIANALKESYAENASLTDALRIAVAALRAGSADTSGGDQPTLGVASLEVAVLDANRPRRAFRRITGSALQALLVDQESP QSDGESSG

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9UK39.2	43	63	30	0.41
sp|Q9H9G7.2	33	47	69	0.58
sp|Q86U90.1	48	67	31	4.7
sp|Q96FQ6.1	31	62	35	5.3
sp|Q8NCP5.1	18	43	69	5.4

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cytoplasmic

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.