From DrugPedia: A Wikipedia for Drug discovery

Revision as of 14:24, 18 January 2010

General

Rv0084, (MTCY251.02), len: 316 aa. Possible hycD (alternate gene name: hevD), formate hydrogenlyase integral membrane protein, similar to others e.g. HYCD_ECOLI|P16430 formate hydrogenlyase subunit 4 from Escherichia coli (307 aa).Also similar to NUOH_ECOLI|P33603 NADH dehydrogenase I chain H from Escherichia coli (325 aa), FASTA scores: opt: 207, E(): 9.5e-06, (26.5% identity in 260 aa overlap). BELONGS TO THE COMPLEX I SUBUNIT 1 FAMILY; hevD

POSSIBLE MOLECULAR FUNTION 1.LYASE ACTIVITY Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring. 2.OXIDOREDUCTASE ACTIVITY Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Protein Sequence

>Rv0084, TB.seq 92326:93273 MW:32154

MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRDLL KQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPS ADLFAVVGLLFLGTVALTLAGIDTGTSFGGMGASREITIAALVEPTI LLAVFALSIPAGSANLGALVASTIDHPGHVVSLAGVLAFVALVIVIV AETGRLPVDNPATHLELTMVHEAMVLEYAGPRLALVEWAAGMRLTVL LALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEVF LAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA