Immunotation of Rv0011C
From DrugPedia: A Wikipedia for Drug discovery
(Difference between revisions)
(New page: Immunotation of Rv0011c (Membrane Protein) General) |
|||
| Line 1: | Line 1: | ||
| - | Immunotation of Rv0011c (Membrane Protein) | + | == Immunotation of Rv0011c (Membrane Protein Mb0011c) UPF 0233 Superfamily == |
| - | General | + | |
| + | |||
| + | |||
| + | |||
| + | == General == | ||
| + | |||
| + | This is a membrane protien for Mycobacterium Tuberclosis. It is responsible for formation of membrane. | ||
| + | |||
| + | |||
| + | == Protein sequence == | ||
| + | |||
| + | >Rv0011c, TB.seq 13717:13995 MW:10430 | ||
| + | MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH | ||
| + | |||
| + | |||
| + | == Human Homologue BLAST result == | ||
| + | |||
| + | No Human Homologue found. | ||
| + | |||
| + | |||
| + | |||
| + | == Alergen Protein == | ||
| + | |||
| + | Link to [http://www.imtech.res.in/raghava/algpred/ Algpred] | ||
| + | |||
| + | The Given Peptide is Not an allergen. | ||
| + | |||
| + | |||
| + | == Bacterial Toxin Prediction == | ||
| + | Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred] | ||
| + | Not a Toxin | ||
| + | |||
| + | |||
| + | |||
| + | == Subcellular Location == | ||
| + | Link to [http://www.imtech.res.in/raghava/tbpred/ tbpred] | ||
Revision as of 09:57, 19 January 2010
Contents |
Immunotation of Rv0011c (Membrane Protein Mb0011c) UPF 0233 Superfamily
General
This is a membrane protien for Mycobacterium Tuberclosis. It is responsible for formation of membrane.
Protein sequence
>Rv0011c, TB.seq 13717:13995 MW:10430 MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH
Human Homologue BLAST result
No Human Homologue found.
Alergen Protein
Link to Algpred
The Given Peptide is Not an allergen.
Bacterial Toxin Prediction
Link to btxpred Not a Toxin
Subcellular Location
Link to tbpred
