Immunotation of Rv0011C
From DrugPedia: A Wikipedia for Drug discovery
(Difference between revisions)
(→Protein sequence) |
|||
Line 12: | Line 12: | ||
>Rv0011c, TB.seq 13717:13995 MW:10430 | >Rv0011c, TB.seq 13717:13995 MW:10430 | ||
- | |||
+ | MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH | ||
== Human Homologue BLAST result == | == Human Homologue BLAST result == |
Revision as of 12:36, 28 January 2010
Contents |
Immunotation of Rv0011c (Membrane Protein Mb0011c) UPF 0233 Superfamily
General
This is a membrane protien for Mycobacterium Tuberclosis. It is responsible for formation of membrane.
Protein sequence
>Rv0011c, TB.seq 13717:13995 MW:10430
MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH
Human Homologue BLAST result
No Human Homologue found.
Alergen Protein
Link to Algpred
The Given Peptide is Not an allergen.
Bacterial Toxin Prediction
Link to btxpred Not a Toxin
Subcellular Location
Link to tbpred