Immunotation of Rv0011C
From DrugPedia: A Wikipedia for Drug discovery
(Difference between revisions)
(→Protein sequence) |
(→Bacterial Toxin Prediction) |
||
| Line 30: | Line 30: | ||
== Bacterial Toxin Prediction == | == Bacterial Toxin Prediction == | ||
Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred] | Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred] | ||
| + | |||
Not a Toxin | Not a Toxin | ||
| - | |||
| - | |||
== Subcellular Location == | == Subcellular Location == | ||
Link to [http://www.imtech.res.in/raghava/tbpred/ tbpred] | Link to [http://www.imtech.res.in/raghava/tbpred/ tbpred] | ||
Revision as of 12:37, 28 January 2010
Contents |
Immunotation of Rv0011c (Membrane Protein Mb0011c) UPF 0233 Superfamily
General
This is a membrane protien for Mycobacterium Tuberclosis. It is responsible for formation of membrane.
Protein sequence
>Rv0011c, TB.seq 13717:13995 MW:10430
MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH
Human Homologue BLAST result
No Human Homologue found.
Alergen Protein
Link to Algpred
The Given Peptide is Not an allergen.
Bacterial Toxin Prediction
Link to btxpred
Not a Toxin
Subcellular Location
Link to tbpred
