Rv2110c
From DrugPedia: A Wikipedia for Drug discovery
Nitinkumar (Talk | contribs)
(New page: {{immunebox | Name =<b> proteasome (beta subunit) PrcB </b> |image= | width=250 |image2= |Swiss Prot = O33245 | Genbank = 887508 | PDB = 2JAY | DrugBa...)
Next diff →
Revision as of 19:34, 12 March 2010
Rv2110c
| |
Name | |
proteasome (beta subunit) PrcB | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | |
Chemical data | |
Formula | C12H6BrN3O4 [1] |
Mol. wt. | 30274 Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 4.41 |
Contents |
General
Helps in Protein degradation. Rv2110c, (MTCY261.06c), len: 291 aa. prcB, proteasome beta-type subunit 2, highly similar to eg. TR:Q53083 (EMBL:U264 22) proteasome beta-type subunit 2 from Rhodococcus (292 aa), FASTA scores; opt: 1103, E(): 0, 64.5% identity in 262 aa overlap. Conserved in M. tuberculosis, M. leprae, M. bovis and M. avium paratuberculosis; predicted to be essential for in vivo survival and pathogenicity (See Ribeiro-Guimaraes and Pessolani, 2007). prcBA genes encode a proteasome with broad substrate specificity (See Lin et al., 2006) . Other PDBID: 3H6I 3HFA 3H6F 3HF9 2FHH 2FHG essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Proteasome encoded by prcBA genes is essential for persistence and optimal growth in mice; Silencing of prcBA results in increased susceptibility to reactive nitrogen intermediates stress and increased resistance to oxidative stress (See Gandotra et al., 2007). mutants available at TARGET website
Protein Sequence
>Rv2110c, TB.seq 2369727:2370599 MW:30274 VTWPLPDRLSINSLSGTPAVDLSSFTDFLRRQAPELLPASISGGAPLAGGDAQLPHGTTIVALKYPGGVVMAGDRRSTQG NMISGRDVRKVYITDDYTATGIAGTAAVAVEFARLYAVELEHYEKLEGVPLTFAGKINRLAIMVRGNLAAAMQGLLALPL LAGYDIHASDPQSAGRIVSFDAAGGWNIEEEGYQAVGSGSLFAKSSMKKLYSQVTDGDSGLRVAVEALYDAADDDSATGG PDLVRGIFPTAVIIDADGAVDVPESRIAELARAIIESRSGADTFGSDGGEK
Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|P28074.3 | 27 | 42 | 250 | 1e-10 |
sp|P28072.4 | 27 | 45 | 192 | 5e-07 |
sp|P28065.2 | 26 | 46 | 202 | 3e-06 |
sp|P28062.2 | 24 | 41 | 234 | 5e-06 |
sp|P49720.2 | 25 | 40 | 186 | 0.021 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
Cytoplasmic
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
IEDB Analysis
Link to IEDB
Result Predicited by [4]
MHC Class-I Binder
nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
IEDB Analysis
Link to IEDB
Result Predicted by [6]
MHC Class-II Binder
Propred Analysis
Link to Propred
Result Predicted by [7]
NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.