Rv2130c
From DrugPedia: A Wikipedia for Drug discovery
(New page: {{immunebox | Name =<b> cysteinyl-tRNA synthetase </b> |image= | width=250 |image2= |Swiss Prot = P67017 | Genbank = 887492 | PDB = | DrugBank ...) |
|||
| Line 41: | Line 41: | ||
<td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | <td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | ||
| - | <tr><td>sp|Q9HA77.1 </td><td> 34</td><td> 48</td><td> 392</td><td> | + | <tr><td>sp|Q9HA77.1 </td><td> 34</td><td> 48</td><td> 392</td><td> 8e-49 </td></tr> |
| - | <tr><td>sp|P49589.3 </td><td> 32</td><td> 51</td><td> 238</td><td> | + | <tr><td>sp|P49589.3 </td><td> 32</td><td> 51</td><td> 238</td><td> 4e-31 </td></tr> |
| - | <tr><td>sp|Q96A72.1 </td><td> 28</td><td> 39</td><td> 105</td><td> | + | <tr><td>sp|Q96A72.1 </td><td> 28</td><td> 39</td><td> 105</td><td> 1.5 </td></tr> |
| - | <tr><td>sp|P61326.1 </td><td> 28</td><td> 39</td><td> 105</td><td> | + | <tr><td>sp|P61326.1 </td><td> 28</td><td> 39</td><td> 105</td><td> 1.8 </td></tr> |
| - | <tr><td>sp|Q9NUQ6.2</td><td> 31</td><td> 44</td><td> 61</td><td> | + | <tr><td>sp|Q9NUQ6.2</td><td> 31</td><td> 44</td><td> 61</td><td> 2.5 </td></tr></table> |
Current revision
| Rv2130c
| |
| Name | |
| cysteinyl-tRNA synthetase | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | C18H22N6O [1] |
| Mol. wt. | 45595 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 5.166 |
Contents |
[edit] General
INVOLVED IN THE THIRD STEP OF MYCOTHIOL BIOSYNTHESIS. Rv2130c, (MTCY261.29c), len: 414 aa. mshC, cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase (see Rawat et al., 2002), similar to several cysteinyl-tRNA synthetases e.g. SYC_ECOLI|P21888 cysteinyl-tRNA synthetase from Escherichia coli (461 aa), FASTA scores: opt: 535, E(): 0, (37.0% identity in 370 aa overlap); etc. Also similar to Mycobacterium tuberculosis cysS|Rv3580c|MTCY06G11.27c, (35.8% identity in 372 aa overlap). Contains a match to Pfam entry PF01406 tRNA synthetases class I (C). Previously known as cysS2. Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website
[edit] Protein Sequence
>Rv2130c, TB.seq 2391216:2392457 MW:45595 MQSWYCPPVPVLPGRGPQLRLYDSADRQVRPVAPGSKATMYVCGITPYDATHLGHAATYVTFDLIHRLWLDLGHELHYVQ NITDIDDPLFERADRDGVDWRDLAQAEVALFCEDMAALRVLPPQDYVGATEAIAEMVELIEKMLACGAAYVIDREMGEYQ DIYFRADATLQFGYESGYDRDTMLRLCEERGGDPRRPGKSDELDALLWRAARPGEPSWPSPFGPGRPGWHVECAAIALSR IGSGLDIQGGGSDLIFPHHEFTAAHAECVSGERRFARHYVHAGMIGWDGHKMSKSRGNLVLVSALRAQDVEPSAVRLGLL AGHYRADRFWSQQVLDEATARLHRWRTATALPAGPAAVDVVARVRRYLADDLDTPKAIAALDGWVTDAVEYGGHDAGAPK LVATAIDALLGVDL
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q9HA77.1 | 34 | 48 | 392 | 8e-49 |
| sp|P49589.3 | 32 | 51 | 238 | 4e-31 |
| sp|Q96A72.1 | 28 | 39 | 105 | 1.5 |
| sp|P61326.1 | 28 | 39 | 105 | 1.8 |
| sp|Q9NUQ6.2 | 31 | 44 | 61 | 2.5 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cytoplasmic
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
