From DrugPedia: A Wikipedia for Drug discovery

---

Current revision

Rv2138
Name
lipoprotein (LppL)
Identifiers
Swiss Prot	O06237
Genbank	887303
PDB	?
Chemical data
Formula	C15H10BrNO4 [1]
Mol. wt.	36819 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	7.7892

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

Function Unknown. Rv2138, (MTCY270.30c), len: 358 aa. Probable lppL, conserved lipoprotein, with appropriately placed lipoprotein signature (PS00013) strongly similar to hypothetical Mycobacterium leprae protein, Q49806. FASTA best: Q49806 B2126_F3_142. (298 aa) opt: 1495, E(): 0; (75.3% identity in 300 aa overlap). Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website.

[edit] Protein Sequence

>Rv2138, TB.seq 2397328:2398401 MW:36819 LLTGNKPAVQRRFIGLLMLSVLVAGCSSNPLANFAPGYPPTIEPAQPAVSPPTSQDPAGAVRPLSGHPRAALFDNGTRQL VALRPGADSAAPASIMVFDDVHVAPRVIFLPGPAAALTSDDHGTAFLAARGGYFVADLSSGHTARVNVADAAHTDFTAIA RRSDGKLVLGSADGAVYTLAKNPAVDPASGAATVASRTKIFARVDALVTQGNTTVVLDRGQTSVTTIGADGHAQQALRAG QGATTMAADPLGRVLIADTRGGQLLVYGVDPLILRQAYPVRQAPYGLAGSRELAWVSQTASNTVIGYDLTTGIPVEKVRY PTVQQPNSLAFDETSDTLYVVSGSGAGVQVIEHAAGTR

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q6XZF7.1	40	54	37	0.47
sp|Q05BV3.3	22	39	204	0.58
sp|Q9UHB4.1	43	51	41	0.77
sp|P42858.1	26	45	45	1.5
sp|Q2Q1W2.1	22	40	149	2.3

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Integral Membrane

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.