Rv2145c
From DrugPedia: A Wikipedia for Drug discovery
(New page: {{immunebox | Name =<b>wag31 </b> |image= | width=250 |image2= |Swiss Prot = P0A5N2 | Genbank = 888224 | PDB = | DrugBank = | chemical_form...) |
|||
| Line 15: | Line 15: | ||
}} | }} | ||
=General= | =General= | ||
| - | CONSERVED HYPOTHETICAL PROTEIN WAG31, cell wall and cell processes | + | CONSERVED HYPOTHETICAL PROTEIN WAG31, cell wall and cell processes, |
Rv2145c, (MTCY270.23), len: 260 aa. wag31 (alternate gene name: ag84). Function unknown but corresponds to antigen 84 of Mycobacterium tuberculosis (wag31) (see Hermans et al., 1995). Predicted to contain significant amount of coiled coil structure. Some similarity to Rv1682 and Rv2927c. FASTA best: AG84_MYCTU P46816 antigen 84. | Rv2145c, (MTCY270.23), len: 260 aa. wag31 (alternate gene name: ag84). Function unknown but corresponds to antigen 84 of Mycobacterium tuberculosis (wag31) (see Hermans et al., 1995). Predicted to contain significant amount of coiled coil structure. Some similarity to Rv1682 and Rv2927c. FASTA best: AG84_MYCTU P46816 antigen 84. | ||
Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website | Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website | ||
Current revision
| Rv2145c
| |
| Name | |
| wag31 | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | C16H19NO2 [1] |
| Mol. wt. | 28278 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 4.5198 |
Contents |
[edit] General
CONSERVED HYPOTHETICAL PROTEIN WAG31, cell wall and cell processes, Rv2145c, (MTCY270.23), len: 260 aa. wag31 (alternate gene name: ag84). Function unknown but corresponds to antigen 84 of Mycobacterium tuberculosis (wag31) (see Hermans et al., 1995). Predicted to contain significant amount of coiled coil structure. Some similarity to Rv1682 and Rv2927c. FASTA best: AG84_MYCTU P46816 antigen 84. Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website
[edit] Protein Sequence
>Rv2145c, TB.seq 2404617:2405396 MW:28278 MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLRQRINELDQELAAGGGAGVTPQATQAIPAYE PEPGKPAPAAVSAGMNEEQALKAARVLSLAQDTADRLTNTAKAESDKMLADARANAEQILGEARHTADATVAEARQRADA MLADAQSRSEAQLRQAQEKADALQADAERKHSEIMGTINQQRAVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSA APVDSNADAGGFDQFNRGKN
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|P24043.4 | 23 | 42 | 228 | 0.093 |
| sp|P50897.1 | 26 | 45 | 84 | 0.29 |
| sp|Q674X7.2 | 37 | 60 | 53 | 0.32 |
| sp|P07942.1 | 22 | 44 | 120 | 0.36 |
| sp|P13647.3 | 30 | 51 | 103 | 0.44 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cytoplasmic
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
