User contributions
From DrugPedia: A Wikipedia for Drug discovery
(Latest | Earliest) View (newer 50) (older 50) (20 | 50 | 100 | 250 | 500)
- 13:07, 16 February 2010 (hist) (diff) Immunotation of Rv0013
- 13:01, 16 February 2010 (hist) (diff) N Image:NetMHCII 2 Rv0013.doc (top)
- 19:35, 14 February 2010 (hist) (diff) Immunotation of Rv0013
- 19:32, 14 February 2010 (hist) (diff) Immunotation of Rv0013
- 19:27, 14 February 2010 (hist) (diff) N Image:ProphedRv0013.doc (top)
- 18:59, 14 February 2010 (hist) (diff) Immunotation of Rv0084 (top)
- 18:57, 14 February 2010 (hist) (diff) Immunotation of Rv0084
- 18:56, 14 February 2010 (hist) (diff) N Image:IEDBRv0013.doc (top)
- 18:43, 14 February 2010 (hist) (diff) N Image:NHLAPredRv0013.doc (top)
- 18:32, 14 February 2010 (hist) (diff) N Image:ABCpred Prediction ServerRv0013.doc (top)
- 18:27, 14 February 2010 (hist) (diff) N Image:Rv0013bcpred.doc (top)
- 18:19, 14 February 2010 (hist) (diff) Immunotation of Rv0013
- 18:06, 14 February 2010 (hist) (diff) Immunotation of Rv0013
- 18:04, 14 February 2010 (hist) (diff) Immunotation of Rv0013
- 17:53, 14 February 2010 (hist) (diff) Immunotation of Rv0013
- 17:51, 14 February 2010 (hist) (diff) N Immunotation of Rv0013 (New page: {{immunebox | Name =<b> POSSIBLE ANTHRANILATE SYNTHASE COMPONENT II TRPG (GLUTAMINE AMIDOTRANSFERASE)</b> |image= | width=250 |image2= |Swiss Prot = Q7DAK6 | Genbank = 88...)
- 17:19, 5 February 2010 (hist) (diff) Immunotation ORFs Assignment
- 05:54, 23 January 2010 (hist) (diff) Immunotation of Rv0084
- 05:47, 23 January 2010 (hist) (diff) Immunotation of Rv0084
- 05:42, 23 January 2010 (hist) (diff) Immunotation of Rv0084
- 05:41, 23 January 2010 (hist) (diff) N Image:NetMHCII 2 Results.doc (top)
- 05:29, 23 January 2010 (hist) (diff) Immunotation of Rv0084
- 05:20, 23 January 2010 (hist) (diff) N Image:MHC Class-II Prophed results.doc (top)
- 05:14, 23 January 2010 (hist) (diff) N Image:MHC-I results IEDB.doc (top)
- 05:07, 23 January 2010 (hist) (diff) N Image:NHLAPredresults.doc (NHLAPredresults) (top)
- 18:38, 21 January 2010 (hist) (diff) Immunotation of Rv0084
- 18:36, 21 January 2010 (hist) (diff) N Image:IEDB Results.pdf (IEDB_Result) (top)
- 18:26, 21 January 2010 (hist) (diff) N Image:ABCpred Prediction Serverresults1.pdf (ABCpred_Prediction_Serverresults) (top)
- 18:13, 21 January 2010 (hist) (diff) Immunotation of Rv0084
- 18:11, 21 January 2010 (hist) (diff) N Image:BcePred Prediction Serverresults1.pdf (Bce_Pred Prediction Results) (top)
- 18:24, 19 January 2010 (hist) (diff) Immunotation of Rv0084
- 17:46, 19 January 2010 (hist) (diff) Immunotation of Rv0084
- 14:57, 18 January 2010 (hist) (diff) Immunotation of Rv0084
- 14:54, 18 January 2010 (hist) (diff) Immunotation of Rv0084
- 14:51, 18 January 2010 (hist) (diff) Immunotation of Rv0084
- 14:49, 18 January 2010 (hist) (diff) Immunotation of Rv0084
- 14:44, 18 January 2010 (hist) (diff) Immunotation of Rv0084
- 14:25, 18 January 2010 (hist) (diff) Immunotation of Rv0084
- 14:25, 18 January 2010 (hist) (diff) Immunotation of Rv0084
- 14:24, 18 January 2010 (hist) (diff) Immunotation of Rv0084
- 14:24, 18 January 2010 (hist) (diff) Immunotation of Rv0084
- 13:35, 18 January 2010 (hist) (diff) Immunotation of Rv0084
- 19:06, 17 January 2010 (hist) (diff) Immunotation of Rv0084 (Replacing page with ''''Protein Sequence''' >Rv0084, TB.seq 92326:93273 MW:32154 MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRDLL KQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPS ADLFAVVGLLFLGTV...')
- 19:06, 17 January 2010 (hist) (diff) Immunotation of Rv0084
- 19:04, 17 January 2010 (hist) (diff) Immunotation of Rv0084
- 19:03, 17 January 2010 (hist) (diff) Immunotation of Rv0084
- 18:49, 17 January 2010 (hist) (diff) Immunotation of Rv0084
- 18:36, 17 January 2010 (hist) (diff) Immunotation of Rv0084
- 18:35, 17 January 2010 (hist) (diff) N Immunotation of Rv0084 (New page: '''Protein Sequence''' >Rv0084, TB.seq 92326:93273 MW:32154 MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRDLLKQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPSADLFAVVGLLFLGTVALTLAGIDTGTSFGGM...)
- 18:16, 17 January 2010 (hist) (diff) Immunotation ORFs Assignment (→Add ORF of interest and Email address)
(Latest | Earliest) View (newer 50) (older 50) (20 | 50 | 100 | 250 | 500)
