From DrugPedia: A Wikipedia for Drug discovery

Immunotation of rv1980c
Name
Identifiers
Swiss Prot	P0A5Q4
Genbank	NP_216496.1
PDB	2HHI
Chemical data
Formula	[1]
Mol. wt.	24,824Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	4.5994

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction

General

Gene name for the entry Rv1980c is mpt64 and its gene product is immunogenic protein MPT64. The MPT64 protein and its homologs form a highly conserved family of secreted proteins with unknown function. The founding member of this family from Mycobacterium tuberculosis (MPT64 or protein Rv1980c) is expressed only when Mycobacteria cells are actively dividing. Examination of the Rv1980c structure in conjunction with multiple sequence alignments of MPT64 homologs identifies a candidate ligand-binding site, which may help guide future studies of Rv1980c function. A comparison showed mpt64 and the gene encoding MPB64 from Mycobacterium bovis BCG Tokyo to be identical except for one silent mutation .

Inhibition of apoptosis of infected macrophages by pathogenic mycobacteria is suggested to be an important virulence mechanism, but little is known about the mycobacterial proteins involved in the inhibition of apoptosis.one of the predominant proteins involved in apoptosis is MPT64.

NR-13273 is a recombinant expression vector containing Mycobacterium tuberculosis gene Rv1980c, which encodes the secreted immunogenic protein Mpt64. Gene Rv1980c was amplified by PCR and cloned into pET15b for expression in Escherichia coli. The gene was cloned without a signal sequence. The expressed protein is histidine-tagged and has an observed molecular weight of 25 kDa. The expected purified protein yield from a one liter culture is approximately 3 mg.

Protein Sequence

>Rv1980c, TB.seq 2223344:2224027 MW:24824 VRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSA ATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFP IVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA

Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q13464	23	42	148	0.14
sp|P98155	29	42	100	0.50
sp|Q8N6C5	24	37	90	2.3
sp|Q8NG31	25	45	55	2.7
sp|Q8WW52	34	48	72	3.1

Alergen Protein

Link to Algpred
Allergen as Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.