Immunotation of rv1980c

From DrugPedia: A Wikipedia for Drug discovery

Revision as of 08:06, 26 January 2010 by Amitfmox4rd (Talk | contribs)
(diff) ←Older revision | Current revision (diff) | Newer revision→ (diff)
Jump to: navigation, search
Immunotation of rv1980c
Name
Immunogenic protein MPT64
Identifiers
Swiss Prot P0A5Q4
Genbank 885925
PDB 2HHI
Chemical data
Formula [1]
Mol. wt. 24,824Da
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 4.5994

Contents

[edit] General

Gene name for the entry Rv1980c is mpt64 and its gene product is immunogenic protein MPT64. The MPT64 protein and its homologs form a highly conserved family of secreted proteins with unknown function. The founding member of this family from Mycobacterium tuberculosis (MPT64 or protein Rv1980c) is expressed only when Mycobacteria cells are actively dividing. Examination of the Rv1980c structure in conjunction with multiple sequence alignments of MPT64 homologs identifies a candidate ligand-binding site, which may help guide future studies of Rv1980c function. A comparison showed mpt64 and the gene encoding MPB64 from Mycobacterium bovis BCG Tokyo to be identical except for one silent mutation .

Inhibition of apoptosis of infected macrophages by pathogenic mycobacteria is suggested to be an important virulence mechanism, but little is known about the mycobacterial proteins involved in the inhibition of apoptosis.one of the predominant proteins involved in apoptosis is MPT64.

NR-13273 is a recombinant expression vector containing Mycobacterium tuberculosis gene Rv1980c, which encodes the secreted immunogenic protein Mpt64. Gene Rv1980c was amplified by PCR and cloned into pET15b for expression in Escherichia coli. The gene was cloned without a signal sequence. The expressed protein is histidine-tagged and has an observed molecular weight of 25 kDa. The expected purified protein yield from a one liter culture is approximately 3 mg.

[edit] Protein Sequence

>Rv1980c, TB.seq 2223344:2224027 MW:24824 VRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSA ATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFP IVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA

[edit] Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|Q13464 23 42 148 0.14
sp|P98155 29 42 100 0.50
sp|Q8N6C5 24 37 90 2.3
sp|Q8NG31 25 45 55 2.7
sp|Q8WW52 34 48 72 3.1

[edit] Alergen Protein

Link to Algpred
Allergen as Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Protein attatched to membrane by lipid anchor

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred

Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.