Immunotation of Rv0011C

From DrugPedia: A Wikipedia for Drug discovery

Revision as of 18:16, 29 January 2010 by Raghavagps (Talk | contribs)
(diff) ←Older revision | Current revision (diff) | Newer revision→ (diff)
Jump to: navigation, search

Contents

[edit] Immunotation of Rv0011c (Membrane Protein Mb0011c) UPF 0233 Superfamily

[edit] General

This is a membrane protien for Mycobacterium Tuberclosis. It is responsible for formation of membrane.


[edit] Protein sequence

>Rv0011c, TB.seq 13717:13995 MW:10430

MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH

[edit] Human Homologue BLAST result

No Human Homologue found.


[edit] Alergen Protein

Link to Algpred

The Given Peptide is Not an allergen.


[edit] Bacterial Toxin Prediction

Link to btxpred

Not a Toxin

[edit] Subcellular Location

Link to tbpred

Retrieved from "http://140949.jxltd.asia/drugpedia/index.php/Immunotation_of_Rv0011C"