From DrugPedia: A Wikipedia for Drug discovery

Rv2130c
Name
cysteinyl-tRNA synthetase
Identifiers
Swiss Prot	P67017
Genbank	887492
PDB	?
Chemical data
Formula	C18H22N6O [1]
Mol. wt.	45595 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	5.166

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

General

INVOLVED IN THE THIRD STEP OF MYCOTHIOL BIOSYNTHESIS. Rv2130c, (MTCY261.29c), len: 414 aa. mshC, cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase (see Rawat et al., 2002), similar to several cysteinyl-tRNA synthetases e.g. SYC_ECOLI|P21888 cysteinyl-tRNA synthetase from Escherichia coli (461 aa), FASTA scores: opt: 535, E(): 0, (37.0% identity in 370 aa overlap); etc. Also similar to Mycobacterium tuberculosis cysS|Rv3580c|MTCY06G11.27c, (35.8% identity in 372 aa overlap). Contains a match to Pfam entry PF01406 tRNA synthetases class I (C). Previously known as cysS2. Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website

Protein Sequence

>Rv2130c, TB.seq 2391216:2392457 MW:45595 MQSWYCPPVPVLPGRGPQLRLYDSADRQVRPVAPGSKATMYVCGITPYDATHLGHAATYVTFDLIHRLWLDLGHELHYVQ NITDIDDPLFERADRDGVDWRDLAQAEVALFCEDMAALRVLPPQDYVGATEAIAEMVELIEKMLACGAAYVIDREMGEYQ DIYFRADATLQFGYESGYDRDTMLRLCEERGGDPRRPGKSDELDALLWRAARPGEPSWPSPFGPGRPGWHVECAAIALSR IGSGLDIQGGGSDLIFPHHEFTAAHAECVSGERRFARHYVHAGMIGWDGHKMSKSRGNLVLVSALRAQDVEPSAVRLGLL AGHYRADRFWSQQVLDEATARLHRWRTATALPAGPAAVDVVARVRRYLADDLDTPKAIAALDGWVTDAVEYGGHDAGAPK LVATAIDALLGVDL

Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9HA77.1	34	48	392	0.0
sp|P49589.3	32	51	238	0.006
sp|Q96A72.1	28	39	105	0.72
sp|P61326.1	28	39	105	0.89
sp|Q9NUQ6.2	31	44	61	1.1

Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred
Cytoplasmic

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

IEDB Analysis

Link to IEDB
Result Predicited by [4]

MHC Class-I Binder

nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

IEDB Analysis

Link to IEDB
Result Predicted by [6]

MHC Class-II Binder

Propred Analysis

Link to Propred
Result Predicted by [7]

NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.