From DrugPedia: A Wikipedia for Drug discovery

Rv2130c
Name
cysteinyl-tRNA synthetase
Identifiers
Swiss Prot	P67017
Genbank	887492
PDB	?
Chemical data
Formula	C18H22N6O [1]
Mol. wt.	45595 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	5.166

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

INVOLVED IN THE THIRD STEP OF MYCOTHIOL BIOSYNTHESIS. Rv2130c, (MTCY261.29c), len: 414 aa. mshC, cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase (see Rawat et al., 2002), similar to several cysteinyl-tRNA synthetases e.g. SYC_ECOLI|P21888 cysteinyl-tRNA synthetase from Escherichia coli (461 aa), FASTA scores: opt: 535, E(): 0, (37.0% identity in 370 aa overlap); etc. Also similar to Mycobacterium tuberculosis cysS|Rv3580c|MTCY06G11.27c, (35.8% identity in 372 aa overlap). Contains a match to Pfam entry PF01406 tRNA synthetases class I (C). Previously known as cysS2. Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website

[edit] Protein Sequence

>Rv2130c, TB.seq 2391216:2392457 MW:45595 MQSWYCPPVPVLPGRGPQLRLYDSADRQVRPVAPGSKATMYVCGITPYDATHLGHAATYVTFDLIHRLWLDLGHELHYVQ NITDIDDPLFERADRDGVDWRDLAQAEVALFCEDMAALRVLPPQDYVGATEAIAEMVELIEKMLACGAAYVIDREMGEYQ DIYFRADATLQFGYESGYDRDTMLRLCEERGGDPRRPGKSDELDALLWRAARPGEPSWPSPFGPGRPGWHVECAAIALSR IGSGLDIQGGGSDLIFPHHEFTAAHAECVSGERRFARHYVHAGMIGWDGHKMSKSRGNLVLVSALRAQDVEPSAVRLGLL AGHYRADRFWSQQVLDEATARLHRWRTATALPAGPAAVDVVARVRRYLADDLDTPKAIAALDGWVTDAVEYGGHDAGAPK LVATAIDALLGVDL

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9HA77.1	34	48	392	8e-49
sp|P49589.3	32	51	238	4e-31
sp|Q96A72.1	28	39	105	1.5
sp|P61326.1	28	39	105	1.8
sp|Q9NUQ6.2	31	44	61	2.5

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cytoplasmic

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.