From DrugPedia: A Wikipedia for Drug discovery

Rv2050
Name
Hypothetical protein
Identifiers
Swiss Prot	O53492
Genbank	888598
PDB	?
Chemical data
Formula	C17H18ClNO3 [1]
Mol. wt.	12972 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	5.334

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

CONSERVED HYPOTHETICAL PROTEIN Rv2050, (MTV018.37), len: 111 aa. Conserved hypothetical protein, similar to hypothetical proteins from Mycobacterium leprae, MLCB2052.03c (113 aa), and Streptomyces coelicolor A3(2), SC6D7.18c (124 aa). FASTA scores: Z98604|MLCB2052_3 Mycobacterium leprae cosmid B2052 (113 aa) opt: 737, E(): 0, (97.3% identity in 111 aa overlap) and (55% identity in 85 aa overlap) with emb|CAB61670.1|AL133213 hypothetical protein SC6D7.18c. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website

[edit] Protein Sequence

>Rv2050, TB.seq 2307819:2308151 MW:12972 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGTLIEGDLPEPKKVKPPRT HWDMLLERRSIEELEELLKERLELIRSRRRG

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9UPA5.4	42	53	28	0.83
sp|Q9P2T1.1	47	57	21	2.3
sp|Q9Y2G1.3	33	46	62	2.8
sp|Q9NQE9.1	31	57	38	2.9
sp|Q96L91.3	47	73	19	4.5

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cytoplasmic

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.