Rv2050
From DrugPedia: A Wikipedia for Drug discovery
| Rv2050
| |
| Name | |
| Hypothetical protein | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | C17H18ClNO3 [1] |
| Mol. wt. | 12972 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 5.334 |
Contents |
[edit] General
CONSERVED HYPOTHETICAL PROTEIN Rv2050, (MTV018.37), len: 111 aa. Conserved hypothetical protein, similar to hypothetical proteins from Mycobacterium leprae, MLCB2052.03c (113 aa), and Streptomyces coelicolor A3(2), SC6D7.18c (124 aa). FASTA scores: Z98604|MLCB2052_3 Mycobacterium leprae cosmid B2052 (113 aa) opt: 737, E(): 0, (97.3% identity in 111 aa overlap) and (55% identity in 85 aa overlap) with emb|CAB61670.1|AL133213 hypothetical protein SC6D7.18c. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website
[edit] Protein Sequence
>Rv2050, TB.seq 2307819:2308151 MW:12972 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGTLIEGDLPEPKKVKPPRT HWDMLLERRSIEELEELLKERLELIRSRRRG
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q9UPA5.4 | 42 | 53 | 28 | 0.83 |
| sp|Q9P2T1.1 | 47 | 57 | 21 | 2.3 |
| sp|Q9Y2G1.3 | 33 | 46 | 62 | 2.8 |
| sp|Q9NQE9.1 | 31 | 57 | 38 | 2.9 |
| sp|Q96L91.3 | 47 | 73 | 19 | 4.5 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cytoplasmic
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
