Rv1714
From DrugPedia: A Wikipedia for Drug discovery
Rv1714
| |
Name | |
oxidoreductase | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | ? |
Chemical data | |
Formula | C16H14ClN3OS [1] |
Mol. wt. | 27955 Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 4.7751 |
Contents[hide] |
[edit] General
FUNCTION UNKNOWN; PROBABLY INVOLVED IN CELLULAR METABOLISM. Rv1714, (MTV048.01), len: 270 aa. Probable oxidoreductase similar to many e.g. AE0010|AE001021_4 Archaeoglobus fulgidus section 79 (281 aa), FASTA scores: opt: 578, E(): 3.3e-31, (38.9% identity in 265 aa overlap). Also similar to several other M. tuberculosis oxidoreductases e.g. Rv1544, etc. Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website
[edit] Protein Sequence
>Rv1714, TB.seq 1941851:1942660 MW:27955 VEEMALAQQVPNLGLARFSVQDKSILITGATGSLGRVAARALADAGARLTLAGGNSAGLAELVNGAGIDDAAVVTCRPDS LADAQQMVEAALGRYGRLDGVLVASGSNHVAPITEMAVEDFDAVMDANVRGAWLVCRAAGRVLLEQGQGGSVVLVSSVRG GLGNAAGYSAYCPSKAGTDLLAKTLAAEWGGHGIRVNALAPTVFRSAVTEWMFTDDPKGRATREAMLARIPLRRFAEPED FVGALIYLLSDASSFYTGQVMYLDGGYTAC
[edit] Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|Q7Z4W1.2 | 34 | 51 | 249 | 3e-29 |
sp|Q9BTZ2.2 | 30 | 51 | 257 | 2e-22 |
sp|Q8N4T8.3 | 31 | 47 | 245 | 4e-22 |
sp|Q9BY49.2 | 24 | 47 | 257 | 3e-19 |
sp|Q92506.2 | 28 | 48 | 251 | 1e-17 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cytoplasmic
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.