Rv2050

From DrugPedia: A Wikipedia for Drug discovery

Jump to: navigation, search
Rv2050
Name
Hypothetical protein
Identifiers
Swiss Prot O53492
Genbank 888598
PDB  ?
Chemical data
Formula C17H18ClNO3 [1]
Mol. wt. 12972 Da
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 5.334

Contents

[hide]

[edit] General

CONSERVED HYPOTHETICAL PROTEIN Rv2050, (MTV018.37), len: 111 aa. Conserved hypothetical protein, similar to hypothetical proteins from Mycobacterium leprae, MLCB2052.03c (113 aa), and Streptomyces coelicolor A3(2), SC6D7.18c (124 aa). FASTA scores: Z98604|MLCB2052_3 Mycobacterium leprae cosmid B2052 (113 aa) opt: 737, E(): 0, (97.3% identity in 111 aa overlap) and (55% identity in 85 aa overlap) with emb|CAB61670.1|AL133213 hypothetical protein SC6D7.18c. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website



[edit] Protein Sequence

>Rv2050, TB.seq 2307819:2308151 MW:12972 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGTLIEGDLPEPKKVKPPRT HWDMLLERRSIEELEELLKERLELIRSRRRG




[edit] Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|Q9UPA5.4 42 53 28 0.83
sp|Q9P2T1.1 47 57 21 2.3
sp|Q9Y2G1.3 33 46 62 2.8
sp|Q9NQE9.1 31 57 38 2.9
sp|Q96L91.3 47 73 19 4.5



[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cytoplasmic

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]


[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.