User contributions
From DrugPedia: A Wikipedia for Drug discovery
(Latest | Earliest) View (newer 50) (older 50) (20 | 50 | 100 | 250 | 500)
- 17:58, 21 April 2010 (hist) (diff) Immunotation of Rv0261c (top)
- 17:39, 21 April 2010 (hist) (diff) Immunotation of Rv0261c
- 17:23, 21 April 2010 (hist) (diff) N Image:MHC Class0261c.doc (top)
- 15:01, 20 April 2010 (hist) (diff) Immunotation of Rv0261c
- 15:00, 20 April 2010 (hist) (diff) N Image:IEDB0261c.doc (top)
- 14:45, 20 April 2010 (hist) (diff) N Image:NHLAPred0261c.doc (top)
- 14:40, 20 April 2010 (hist) (diff) Immunotation of Rv0261c
- 14:39, 20 April 2010 (hist) (diff) N Image:Sequence0261c.doc (top)
- 14:35, 20 April 2010 (hist) (diff) N Image:ABCpred Prediction Server0261c.doc (top)
- 14:33, 20 April 2010 (hist) (diff) N Image:BcePred Prediction Server0261c.doc (top)
- 14:31, 20 April 2010 (hist) (diff) Immunotation of Rv0261c
- 14:22, 20 April 2010 (hist) (diff) N Immunotation of Rv0261c (New page: {{immunebox | Name =<Rv0032> POSSIBLE 8-AMINO-7-OXONONANOATE SYNTHASE BIOF2 |image= | width=250 |image2= |Swiss Prot = P95218 | Genbank = CAB06688 | PDB = no struc...)
- 15:31, 16 April 2010 (hist) (diff) Immunotation of Rv0260c (top)
- 15:30, 16 April 2010 (hist) (diff) N Image:NetMHCII-0260c.doc (top)
- 15:17, 16 April 2010 (hist) (diff) N Image:MHC ClassIIprophed0260c.doc (top)
- 15:11, 16 April 2010 (hist) (diff) N Image:IEDB0260c.doc (top)
- 15:03, 16 April 2010 (hist) (diff) N Image:NHLAPred0260c.doc (top)
- 14:54, 16 April 2010 (hist) (diff) Immunotation of Rv0260c
- 14:54, 16 April 2010 (hist) (diff) N Immunotation of Rv0260c (New page: {{immunebox | Name =<b> PPOSIBLE TRANSCRIPTIONAL REGULATORY PROTEIN </b> |image= | width=250 |image2= |Swiss Prot = P95217 | Genbank =923195[http://www.ncbi.nlm.nih.gov/si...)
- 14:53, 16 April 2010 (hist) (diff) N Image:SequenceIEDB0260c.doc (top)
- 14:49, 16 April 2010 (hist) (diff) N Image:ABCpred Prediction Server0260c.doc (top)
- 14:43, 16 April 2010 (hist) (diff) N Image:BcePred Prediction Server0260c.doc (top)
- 14:13, 16 April 2010 (hist) (diff) Immunotation of Rv3459c (top)
- 14:12, 16 April 2010 (hist) (diff) N Image:NetMHCII3459c.doc (top)
- 17:07, 15 April 2010 (hist) (diff) Immunotation of Rv1902c (top)
- 17:05, 15 April 2010 (hist) (diff) N Image:NetmhcII01902c1.doc (top)
- 16:19, 15 April 2010 (hist) (diff) N Image:Prophred1902c.doc (top)
- 16:14, 15 April 2010 (hist) (diff) Immunotation ORFs Assignment (top)
- 10:06, 15 April 2010 (hist) (diff) N Image:ProphedMHC ClassII1902c.doc (top)
- 09:54, 15 April 2010 (hist) (diff) Immunotation of Rv1902c
- 09:47, 15 April 2010 (hist) (diff) N Image:IEDB1902c.doc (top)
- 09:39, 15 April 2010 (hist) (diff) N Image:NHLAPred1902c.doc (top)
- 09:29, 15 April 2010 (hist) (diff) Immunotation of Rv1902c
- 09:28, 15 April 2010 (hist) (diff) N Image:IEDB analysis 1902c.doc (top)
- 09:22, 15 April 2010 (hist) (diff) N Image:AbcPred1902c.doc (top)
- 09:18, 15 April 2010 (hist) (diff) N Image:BcePred Prediction Server1902c.doc (top)
- 09:54, 10 April 2010 (hist) (diff) Immunotation of Rv1902c
- 09:34, 10 April 2010 (hist) (diff) Immunotation of Rv1902c
- 06:29, 10 April 2010 (hist) (diff) Immunotation ORFs Assignment
- 06:22, 10 April 2010 (hist) (diff) Immunotation ORFs Assignment
- 10:46, 9 April 2010 (hist) (diff) Immunotation of Rv1902c
- 10:31, 9 April 2010 (hist) (diff) Immunotation of Rv1902c
- 10:12, 9 April 2010 (hist) (diff) Immunotation ORFs Assignment
- 10:08, 9 April 2010 (hist) (diff) Immunotation of Rv1902c
- 09:50, 9 April 2010 (hist) (diff) N Immunotation of Rv1902c (New page: >Rv1902c, TB.seq 2149007:2150272 MW:46422 VAAPRLTGDQRNAFMASFLGWTMDAFDYFLVVLVYADIATTFHHTKTDVAFLTTATLAMRPVGALLFGLWADRVGRRVPL MVDVSFYSVIGFLCAFAPNFTVLVILRLLYGIGMGGEWGLGAALSMEKVPAERRGVFSGLLQE...)
- 18:46, 29 March 2010 (hist) (diff) Immunotation of Rv3459c
- 18:45, 29 March 2010 (hist) (diff) N Image:MHC Class-II prophed3459c.doc (top)
- 18:26, 21 March 2010 (hist) (diff) Immunotation ORFs Assignment
- 16:10, 19 March 2010 (hist) (diff) Immunotation of Rv3459c
- 16:06, 19 March 2010 (hist) (diff) N Image:MHC-1-2.doc (top)
(Latest | Earliest) View (newer 50) (older 50) (20 | 50 | 100 | 250 | 500)
