|
|
| Line 11: |
Line 11: |
| | LALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEVF | | LALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEVF |
| | LAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA | | LAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA |
| - |
| |
| - |
| |
| - | =General=
| |
| - | dapA catalyzes the formation of dihydrodipicolinate from L-aspartate 4-semialdehyde and pyruvate.
| |
| - |
| |
| - | L-aspartate 4-semialdehyde + pyruvate = dihydrodipicolinate + 2H<sub>2</sub>O.
| |
| - |
| |
| - | This protein is eesential for optimal growth of M.tb and found in the cytoplasm as predicted by the [http://www.imtech.res.in/raghava/tbpred/ TBpred]. HMMpfam found one domain PF00701 and has Helix Turn Helix secondary structure.
| |
| - | ==Protein Sequence==
| |
| - | >Rv2753c, TB.seq 3066222:3067121 MW:30827
| |
| - | VTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDR
| |
| - | ARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRA
| |
| - | LASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKI
| |
| - | NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
| |
| - |
| |
| - | =Human Homologue Blast Result=
| |
| - |
| |
| - | <table border='1'><tr>
| |
| - |
| |
| - | <td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr>
| |
| - |
| |
| - | <tr><td>sp|Q9BXD5</td><td> 28</td><td> 46.33</td><td> 300</td><td> 3.00E-023</td></tr>
| |
| - |
| |
| - | <tr><td>sp|Q86XE5</td><td> 26.57</td><td> 46.15</td><td> 286</td><td> 4.00E-022</td></tr>
| |
| - |
| |
| - | <tr><td>sp|Q9UG63</td><td> 26.49</td><td> 37.75</td><td> 151</td><td> 0.45</td></tr>
| |
| - |
| |
| - | <tr><td>sp|O14556</td><td> 22.09</td><td> 50</td><td> 86</td><td> 2</td></tr>
| |
| - |
| |
| - | <tr><td>sp|Q7Z7B0</td><td> 27.69</td><td> 44.62</td><td> 65</td><td> 2.7</td></tr></table>
| |
| - |
| |
| - | =Alergen Protein=
| |
| - | Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br>
| |
| - | Non Allergen Predicted by AlgPred Server
| |
| - | =Bacterial Toxin Prediction=
| |
| - | Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br>
| |
| - | No Hit Fountd by btxpred server.
| |
| - | =Subcellular Location=
| |
| - | Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br>
| |
| - | Cyoplasmic
| |
| - |
| |
| - | =Antigens=
| |
| - | No Hit Found in [http://www.imtech.res.in/raghava/antigendb/keyquery.html AntigenDB]<br>
| |
| - | No. Hit Found in [http://www.iedb.org/ IEDB]
| |
| - | ==B cell Epitopes==
| |
| - | ====BCEpred Analysis====
| |
| - |
| |
| - | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred]
| |
| - | <br>
| |
| - | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br>
| |
| - |
| |
| - | ====ABCpred Analysis====
| |
| - | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br>
| |
| - | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Abcpred_rv2753c.pdf ABCPred]<br>
| |
| - |
| |
| - | ====IEDB Analysis====
| |
| - | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br>
| |
| - | Result Predicited by [http://crdd.osdd.net/drugpedia/images/IEDB_rv2753c.pdf IEDB]<br>
| |
| - |
| |
| - | =MHC Class-I Binder=
| |
| - | ==nHLAPred Analysis==
| |
| - | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred]
| |
| - | <br>
| |
| - | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Nhlapred_rv2753c.pdf nHLApred]<br>
| |
| - | ==IEDB Analysis==
| |
| - | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br>
| |
| - | Result Predicted by [http://crdd.osdd.net/drugpedia/images/IEDB_mhc_rv2753c.pdf IEDB]
| |
| - |
| |
| - | =MHC Class-II Binder=
| |
| - | ==Propred Analysis==
| |
| - | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br>
| |
| - | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Propred_rv2753c.pdf Propred]
| |
| - |
| |
| - |
| |
| - | ==NetMHC-II Analysis==
| |
| - | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br>
| |
| - | Result Predicted by [http://crdd.osdd.net/drugpedia/images/NetMHC-II_rv2753c.pdf NetMHC-II]
| |
| - |
| |
| - | =External Links=
| |
| - | * [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information.
| |
| - |
| |
| - | [[Category:C2D]]
| |
| - | [[Category:Mtb Immunotation]]
| |
