Immunotation of Rv0084
From DrugPedia: A Wikipedia for Drug discovery
| Line 6: | Line 6: | ||
|Swiss Prot = Q10881 | |Swiss Prot = Q10881 | ||
| Genbank = 886959 | | Genbank = 886959 | ||
| - | |||
| PDB = 1XXX | | PDB = 1XXX | ||
| DrugBank = | | DrugBank = | ||
| chemical_formula = C28H37ClN4O6 [http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=18062777&loc=ec_rcs#Properties] | | chemical_formula = C28H37ClN4O6 [http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=18062777&loc=ec_rcs#Properties] | ||
| - | | molecular_weight = | + | | molecular_weight = 32152.9 Da |
| solubility = | | solubility = | ||
| - | |Isoelectric-Point = | + | |Isoelectric-Point = 6.52 |
}} | }} | ||
| - | ''' | + | =General= |
| + | Rv0084, (MTCY251.02), len: 316 aa. Possible hycD (alternate gene name: hevD), formate hydrogenlyase integral membrane protein, similar to others e.g. HYCD_ECOLI|P16430 formate hydrogenlyase subunit 4 from Escherichia coli (307 aa).Also similar to NUOH_ECOLI|P33603 NADH dehydrogenase I chain H from Escherichia coli (325 aa), FASTA scores: opt: 207, E(): 9.5e-06, (26.5% identity in 260 aa overlap). BELONGS TO THE COMPLEX I SUBUNIT 1 FAMILY.; hevD | ||
| + | '''POSSIBLE MOLECULAR FUNTION''' | ||
| + | 1.LYASE ACTIVITY | ||
| + | Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring. | ||
| + | 2.OXIDOREDUCTASE ACTIVITY | ||
| + | Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced. | ||
| + | |||
| + | |||
| + | ==Protein Sequence== | ||
>Rv0084, TB.seq 92326:93273 MW:32154 | >Rv0084, TB.seq 92326:93273 MW:32154 | ||
Revision as of 14:24, 18 January 2010
| Immunotation of Rv0084
| |
| Name | |
| POSSIBLE FORMATE HYDROGENLYASE HYCD (FHL) | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | |
| Chemical data | |
| Formula | C28H37ClN4O6 [1] |
| Mol. wt. | 32152.9 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 6.52 |
General
Rv0084, (MTCY251.02), len: 316 aa. Possible hycD (alternate gene name: hevD), formate hydrogenlyase integral membrane protein, similar to others e.g. HYCD_ECOLI|P16430 formate hydrogenlyase subunit 4 from Escherichia coli (307 aa).Also similar to NUOH_ECOLI|P33603 NADH dehydrogenase I chain H from Escherichia coli (325 aa), FASTA scores: opt: 207, E(): 9.5e-06, (26.5% identity in 260 aa overlap). BELONGS TO THE COMPLEX I SUBUNIT 1 FAMILY.; hevD POSSIBLE MOLECULAR FUNTION 1.LYASE ACTIVITY Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring. 2.OXIDOREDUCTASE ACTIVITY Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
Protein Sequence
>Rv0084, TB.seq 92326:93273 MW:32154
MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRDLL
KQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPS
ADLFAVVGLLFLGTVALTLAGIDTGTSFGGMGASREITIAALVEPTI
LLAVFALSIPAGSANLGALVASTIDHPGHVVSLAGVLAFVALVIVIV
AETGRLPVDNPATHLELTMVHEAMVLEYAGPRLALVEWAAGMRLTVL
LALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEVF
LAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA
