Immunotation of Rv0084
From DrugPedia: A Wikipedia for Drug discovery
Line 46: | Line 46: | ||
<tr><td>sp|P03886.1|</td><td> 25</td><td> 47</td><td> 318</td><td> 0.045</td></tr> | <tr><td>sp|P03886.1|</td><td> 25</td><td> 47</td><td> 318</td><td> 0.045</td></tr> | ||
- | <tr><td>sp|Q709C8.1|</td><td> 23</td><td> 42</td><td> 3753</td><td> 3.9</td></tr> | + | <tr><td>sp|Q709C8.1|</td><td> 23</td><td> 42</td><td> 3753</td><td> 3.9</td></tr> |
+ | |||
+ | <tr><td>sp|Q53EL9.2|</td><td> 28</td><td> 47</td><td> 994</td><td> 3.9</td></tr></table> | ||
- | |||
=Alergen Protein= | =Alergen Protein= | ||
Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | ||
Non Allergen Predicted by AlgPred Server | Non Allergen Predicted by AlgPred Server |
Revision as of 14:51, 18 January 2010
Immunotation of Rv0084
| |
Name | |
POSSIBLE FORMATE HYDROGENLYASE HYCD (FHL) | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | ? |
Chemical data | |
Formula | C28H37ClN4O6 [1] |
Mol. wt. | 32152.9 Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 6.52 |
Contents |
General
Rv0084, (MTCY251.02), len: 316 aa. Possible hycD (alternate gene name: hevD), formate hydrogenlyase integral membrane protein, similar to others e.g. HYCD_ECOLI|P16430 formate hydrogenlyase subunit 4 from Escherichia coli (307 aa).Also similar to NUOH_ECOLI|P33603 NADH dehydrogenase I chain H from Escherichia coli (325 aa), FASTA scores: opt: 207, E(): 9.5e-06, (26.5% identity in 260 aa overlap). BELONGS TO THE COMPLEX I SUBUNIT 1 FAMILY; hevD
POSSIBLE MOLECULAR FUNTION
1.LYASE ACTIVITY Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
2.OXIDOREDUCTASE ACTIVITY Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
Protein Sequence
>Rv0084, TB.seq 92326:93273 MW:32154
MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRDLL
KQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPS
ADLFAVVGLLFLGTVALTLAGIDTGTSFGGMGASREITIAALVEPTI
LLAVFALSIPAGSANLGALVASTIDHPGHVVSLAGVLAFVALVIVIV
AETGRLPVDNPATHLELTMVHEAMVLEYAGPRLALVEWAAGMRLTVL
LALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEVF
LAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA
Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|P03886.1| | 25 | 47 | 318 | 0.045 |
sp|Q709C8.1| | 23 | 42 | 3753 | 3.9 |
sp|Q53EL9.2| | 28 | 47 | 994 | 3.9 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server