Immunotation of Rv0084
From DrugPedia: A Wikipedia for Drug discovery
| Line 65: | Line 65: | ||
=Antigens= | =Antigens= | ||
No Hit Found in [http://www.imtech.res.in/raghava/antigendb/keyquery.html AntigenDB]<br> | No Hit Found in [http://www.imtech.res.in/raghava/antigendb/keyquery.html AntigenDB]<br> | ||
| - | IEDB | + | No. Hit Found in [http://www.iedb.org/ IEDB] |
| - | + | ||
| - | + | ==B cell Epitopes== | |
| - | + | ====BCEpred Analysis==== | |
| - | + | ||
Revision as of 18:24, 19 January 2010
| Immunotation of Rv0084
| |
| Name | |
| POSSIBLE FORMATE HYDROGENLYASE HYCD (FHL) | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 32152.9 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 6.52 |
Contents |
General
Rv0084, (MTCY251.02), len: 316 aa. Possible hycD (alternate gene name: hevD), formate hydrogenlyase integral membrane protein, similar to others e.g. HYCD_ECOLI|P16430 formate hydrogenlyase subunit 4 from Escherichia coli (307 aa).Also similar to NUOH_ECOLI|P33603 NADH dehydrogenase I chain H from Escherichia coli (325 aa), FASTA scores: opt: 207, E(): 9.5e-06, (26.5% identity in 260 aa overlap). BELONGS TO THE COMPLEX I SUBUNIT 1 FAMILY; hevD
POSSIBLE MOLECULAR FUNTION
1.LYASE ACTIVITY Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
2.OXIDOREDUCTASE ACTIVITY Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
Protein Sequence
>Rv0084, TB.seq 92326:93273 MW:32154
MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRDLL
KQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPS
ADLFAVVGLLFLGTVALTLAGIDTGTSFGGMGASREITIAALVEPTI
LLAVFALSIPAGSANLGALVASTIDHPGHVVSLAGVLAFVALVIVIV
AETGRLPVDNPATHLELTMVHEAMVLEYAGPRLALVEWAAGMRLTVL
LALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEVF
LAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA
Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|P03886.1| | 25 | 47 | 318 | 0.045 |
| sp|Q709C8.1| | 23 | 42 | 3753 | 3.9 |
| sp|Q53EL9.2| | 28 | 47 | 994 | 3.9 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
Integral Membrane Protein
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
