From DrugPedia: A Wikipedia for Drug discovery

Revision as of 05:42, 23 January 2010

General

Rv0084, (MTCY251.02), len: 316 aa. Possible hycD (alternate gene name: hevD), formate hydrogenlyase integral membrane protein, similar to others e.g. HYCD_ECOLI|P16430 formate hydrogenlyase subunit 4 from Escherichia coli (307 aa).Also similar to NUOH_ECOLI|P33603 NADH dehydrogenase I chain H from Escherichia coli (325 aa), FASTA scores: opt: 207, E(): 9.5e-06, (26.5% identity in 260 aa overlap). BELONGS TO THE COMPLEX I SUBUNIT 1 FAMILY; hevD

POSSIBLE MOLECULAR FUNTION

1.LYASE ACTIVITY Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.

2.OXIDOREDUCTASE ACTIVITY Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Protein Sequence

>Rv0084, TB.seq 92326:93273 MW:32154

MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRDLL KQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPS ADLFAVVGLLFLGTVALTLAGIDTGTSFGGMGASREITIAALVEPTI LLAVFALSIPAGSANLGALVASTIDHPGHVVSLAGVLAFVALVIVIV AETGRLPVDNPATHLELTMVHEAMVLEYAGPRLALVEWAAGMRLTVL LALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEVF LAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA

Human Homologue Blast Result

Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred
Integral Membrane Protein

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred  
Result Predicited by [1]

ABCpred Analysis

Link to ABCpred
Result Predicted By [2]

IEDB Analysis

Link to IEDB
Result Predicited by [3]

MHC Class-II Binder

Propred Analysis

Link to Propred
Results[4]

IEDB Analysis

Link to IEDB
Results[5]

MHC Class-II Binder

Propred Analysis

Link to Propred
Results[6]

NetMHC-II Analysis

Link to NetMHC-II
Results[7]

External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.