Immunotation of Rv0084

From DrugPedia: A Wikipedia for Drug discovery

(Difference between revisions)
Jump to: navigation, search
Current revision (18:59, 14 February 2010) (edit) (undo)
 
(20 intermediate revisions not shown.)
Line 1: Line 1:
-
'''Protein Sequence'''
+
{{immunebox
 +
| Name        =<b> POSSIBLE FORMATE HYDROGENLYASE HYCD (FHL)</b>
 +
|image=
 +
| width=250
 +
|image2=
 +
|Swiss Prot =  Q10881
 +
| Genbank          = 886959
 +
| PDB        =
 +
| DrugBank          =
 +
| chemical_formula  = [http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=7711&loc=ec_rcs]
 +
| molecular_weight  = 32152.9 Da
 +
| solubility        =
 +
|Isoelectric-Point = 6.52
 +
}}
 +
=General=
 +
Rv0084, (MTCY251.02), len: 316 aa. Possible hycD (alternate gene name: hevD), formate hydrogenlyase  integral membrane protein, similar to others e.g. HYCD_ECOLI|P16430 formate hydrogenlyase subunit 4 from Escherichia coli (307 aa).Also similar to NUOH_ECOLI|P33603 NADH dehydrogenase I chain H from Escherichia coli (325 aa), FASTA scores: opt: 207, E(): 9.5e-06, (26.5% identity in 260 aa overlap). BELONGS TO THE COMPLEX I SUBUNIT 1 FAMILY; hevD
 +
 
 +
 
 +
'''POSSIBLE MOLECULAR FUNTION'''
 +
 
 +
1.LYASE ACTIVITY
 +
Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
 +
 
 +
2.OXIDOREDUCTASE ACTIVITY
 +
Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
 +
 
 +
 
 +
==Protein Sequence==
>Rv0084, TB.seq  92326:93273 MW:32154  
>Rv0084, TB.seq  92326:93273 MW:32154  
Line 11: Line 38:
LALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEVF
LALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEVF
LAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA
LAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA
-
 
-
 
-
=General=
 
-
dapA catalyzes the formation of dihydrodipicolinate from L-aspartate 4-semialdehyde and pyruvate.
 
-
 
-
L-aspartate 4-semialdehyde + pyruvate = dihydrodipicolinate + 2H<sub>2</sub>O.
 
-
 
-
This protein is eesential for optimal growth of M.tb and found in the cytoplasm as predicted by the [http://www.imtech.res.in/raghava/tbpred/ TBpred]. HMMpfam found one domain PF00701 and has Helix Turn Helix secondary structure.
 
-
==Protein Sequence==
 
-
>Rv2753c, TB.seq  3066222:3067121 MW:30827
 
-
VTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDR
 
-
ARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRA
 
-
LASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKI
 
-
NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
 
=Human Homologue Blast Result=
=Human Homologue Blast Result=
-
 
<table border='1'><tr>
<table border='1'><tr>
<td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr>
<td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr>
-
<tr><td>sp|Q9BXD5</td><td> 28</td><td> 46.33</td><td> 300</td><td> 3.00E-023</td></tr>
+
<tr><td>sp|P03886.1|</td><td> 25</td><td> 47</td><td> 318</td><td> 0.045</td></tr>  
-
<tr><td>sp|Q86XE5</td><td> 26.57</td><td> 46.15</td><td> 286</td><td> 4.00E-022</td></tr>
+
<tr><td>sp|Q709C8.1|</td><td> 23</td><td> 42</td><td> 3753</td><td>   3.9</td></tr>
-
<tr><td>sp|Q9UG63</td><td> 26.49</td><td> 37.75</td><td> 151</td><td> 0.45</td></tr>
+
<tr><td>sp|Q53EL9.2|</td><td> 28</td><td> 47</td><td> 994</td><td>   3.9</td></tr></table>
-
<tr><td>sp|O14556</td><td> 22.09</td><td> 50</td><td> 86</td><td> 2</td></tr>
 
-
 
-
<tr><td>sp|Q7Z7B0</td><td> 27.69</td><td> 44.62</td><td> 65</td><td> 2.7</td></tr></table>
 
=Alergen Protein=
=Alergen Protein=
Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br>
Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br>
Non Allergen Predicted by AlgPred Server
Non Allergen Predicted by AlgPred Server
 +
=Bacterial Toxin Prediction=
=Bacterial Toxin Prediction=
Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br>
Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br>
No Hit Fountd by btxpred server.
No Hit Fountd by btxpred server.
 +
=Subcellular Location=
=Subcellular Location=
Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br>
Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br>
-
Cyoplasmic
+
Integral Membrane Protein
=Antigens=
=Antigens=
No Hit Found in [http://www.imtech.res.in/raghava/antigendb/keyquery.html AntigenDB]<br>
No Hit Found in [http://www.imtech.res.in/raghava/antigendb/keyquery.html AntigenDB]<br>
No. Hit Found in [http://www.iedb.org/ IEDB]
No. Hit Found in [http://www.iedb.org/ IEDB]
 +
==B cell Epitopes==
==B cell Epitopes==
====BCEpred Analysis====
====BCEpred Analysis====
-
 
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred]  
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred]  
<br>
<br>
-
Result Predicited by  [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br>
+
Result Predicited by  [http://crdd.osdd.net/drugpedia/index.php/Image:BcePred_Prediction_Serverresults1.pdf]<br>
====ABCpred Analysis====
====ABCpred Analysis====
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br>
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br>
-
Result Predicited by  [http://crdd.osdd.net/drugpedia/images/Abcpred_rv2753c.pdf ABCPred]<br>
+
Result Predicted By
 +
[http://crdd.osdd.net/drugpedia/index.php/Image:ABCpred_Prediction_Serverresults1.pdf]<br>
====IEDB Analysis====
====IEDB Analysis====
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br>
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br>
-
Result Predicited by  [http://crdd.osdd.net/drugpedia/images/IEDB_rv2753c.pdf IEDB]<br>
+
Result Predicited by  [http://crdd.osdd.net/drugpedia/index.php/Image:IEDB_Results.pdf]<br>
=MHC Class-I Binder=
=MHC Class-I Binder=
-
==nHLAPred Analysis==
+
==NHLA Analysis==
-
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred]
+
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html]<br>
-
<br>  
+
Results[http://crdd.osdd.net/drugpedia/index.php/Image:NHLAPredresults.doc]<br>
-
Result Predicited by  [http://crdd.osdd.net/drugpedia/images/Nhlapred_rv2753c.pdf nHLApred]<br>
+
 
==IEDB Analysis==
==IEDB Analysis==
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br>
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br>
-
Result Predicted by [http://crdd.osdd.net/drugpedia/images/IEDB_mhc_rv2753c.pdf IEDB]
+
Results[http://crdd.osdd.net/drugpedia/index.php/Image:MHC-I_results_IEDB.doc]<br>
=MHC Class-II Binder=
=MHC Class-II Binder=
==Propred Analysis==
==Propred Analysis==
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br>
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br>
-
Result Predicted by [http://crdd.osdd.net/drugpedia/images/Propred_rv2753c.pdf Propred]
+
Results[http://crdd.osdd.net/drugpedia/index.php/Image:MHC_Class-II_Prophed_results.doc]<br>
-
 
+
==NetMHC-II Analysis==
==NetMHC-II Analysis==
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br>
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br>
-
Result Predicted by [http://crdd.osdd.net/drugpedia/images/NetMHC-II_rv2753c.pdf NetMHC-II]
+
Results[http://crdd.osdd.net/drugpedia/index.php/Image:NetMHCII_2_Results.doc]<br>
=External Links=
=External Links=

Current revision

Immunotation of Rv0084
Name
POSSIBLE FORMATE HYDROGENLYASE HYCD (FHL)
Identifiers
Swiss Prot Q10881
Genbank 886959
PDB  ?
Chemical data
Formula [1]
Mol. wt. 32152.9 Da
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 6.52

Contents

[edit] General

Rv0084, (MTCY251.02), len: 316 aa. Possible hycD (alternate gene name: hevD), formate hydrogenlyase integral membrane protein, similar to others e.g. HYCD_ECOLI|P16430 formate hydrogenlyase subunit 4 from Escherichia coli (307 aa).Also similar to NUOH_ECOLI|P33603 NADH dehydrogenase I chain H from Escherichia coli (325 aa), FASTA scores: opt: 207, E(): 9.5e-06, (26.5% identity in 260 aa overlap). BELONGS TO THE COMPLEX I SUBUNIT 1 FAMILY; hevD


POSSIBLE MOLECULAR FUNTION

1.LYASE ACTIVITY Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.

2.OXIDOREDUCTASE ACTIVITY Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.


[edit] Protein Sequence

>Rv0084, TB.seq 92326:93273 MW:32154


MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRDLL KQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPS ADLFAVVGLLFLGTVALTLAGIDTGTSFGGMGASREITIAALVEPTI LLAVFALSIPAGSANLGALVASTIDHPGHVVSLAGVLAFVALVIVIV AETGRLPVDNPATHLELTMVHEAMVLEYAGPRLALVEWAAGMRLTVL LALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEVF LAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA

[edit] Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|P03886.1| 25 47 318 0.045
sp|Q709C8.1| 23 42 3753 3.9
sp|Q53EL9.2| 28 47 994 3.9


[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Integral Membrane Protein

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred  
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicted By [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] NHLA Analysis

Link to [5]
Results[6]

[edit] IEDB Analysis

Link to IEDB
Results[7]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Results[8]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Results[9]

[edit] External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.
Retrieved from "http://140949.jxltd.asia/drugpedia/index.php/Immunotation_of_Rv0084"