Immunotation of Rv0084
From DrugPedia: A Wikipedia for Drug discovery
| (6 intermediate revisions not shown.) | |||
| Line 8: | Line 8: | ||
| PDB = | | PDB = | ||
| DrugBank = | | DrugBank = | ||
| - | | chemical_formula = | + | | chemical_formula = [http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=7711&loc=ec_rcs] |
| molecular_weight = 32152.9 Da | | molecular_weight = 32152.9 Da | ||
| solubility = | | solubility = | ||
| Line 75: | Line 75: | ||
====ABCpred Analysis==== | ====ABCpred Analysis==== | ||
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
| + | Result Predicted By | ||
| + | [http://crdd.osdd.net/drugpedia/index.php/Image:ABCpred_Prediction_Serverresults1.pdf]<br> | ||
| + | |||
| + | ====IEDB Analysis==== | ||
| + | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/index.php/Image:IEDB_Results.pdf]<br> | ||
| + | |||
| + | =MHC Class-I Binder= | ||
| + | ==NHLA Analysis== | ||
| + | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html]<br> | ||
| + | Results[http://crdd.osdd.net/drugpedia/index.php/Image:NHLAPredresults.doc]<br> | ||
| + | |||
| + | ==IEDB Analysis== | ||
| + | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| + | Results[http://crdd.osdd.net/drugpedia/index.php/Image:MHC-I_results_IEDB.doc]<br> | ||
| + | |||
| + | =MHC Class-II Binder= | ||
| + | ==Propred Analysis== | ||
| + | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| + | Results[http://crdd.osdd.net/drugpedia/index.php/Image:MHC_Class-II_Prophed_results.doc]<br> | ||
| + | |||
| + | ==NetMHC-II Analysis== | ||
| + | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| + | Results[http://crdd.osdd.net/drugpedia/index.php/Image:NetMHCII_2_Results.doc]<br> | ||
| + | |||
| + | =External Links= | ||
| + | * [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information. | ||
| + | |||
| + | [[Category:C2D]] | ||
| + | [[Category:Mtb Immunotation]] | ||
Current revision
| Immunotation of Rv0084
| |
| Name | |
| POSSIBLE FORMATE HYDROGENLYASE HYCD (FHL) | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | [1] |
| Mol. wt. | 32152.9 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 6.52 |
Contents |
[edit] General
Rv0084, (MTCY251.02), len: 316 aa. Possible hycD (alternate gene name: hevD), formate hydrogenlyase integral membrane protein, similar to others e.g. HYCD_ECOLI|P16430 formate hydrogenlyase subunit 4 from Escherichia coli (307 aa).Also similar to NUOH_ECOLI|P33603 NADH dehydrogenase I chain H from Escherichia coli (325 aa), FASTA scores: opt: 207, E(): 9.5e-06, (26.5% identity in 260 aa overlap). BELONGS TO THE COMPLEX I SUBUNIT 1 FAMILY; hevD
POSSIBLE MOLECULAR FUNTION
1.LYASE ACTIVITY Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
2.OXIDOREDUCTASE ACTIVITY Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
[edit] Protein Sequence
>Rv0084, TB.seq 92326:93273 MW:32154
MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRDLL
KQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPS
ADLFAVVGLLFLGTVALTLAGIDTGTSFGGMGASREITIAALVEPTI
LLAVFALSIPAGSANLGALVASTIDHPGHVVSLAGVLAFVALVIVIV
AETGRLPVDNPATHLELTMVHEAMVLEYAGPRLALVEWAAGMRLTVL
LALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEVF
LAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|P03886.1| | 25 | 47 | 318 | 0.045 |
| sp|Q709C8.1| | 23 | 42 | 3753 | 3.9 |
| sp|Q53EL9.2| | 28 | 47 | 994 | 3.9 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Integral Membrane Protein
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicted By
[3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] NHLA Analysis
[edit] IEDB Analysis
[edit] MHC Class-II Binder
[edit] Propred Analysis
[edit] NetMHC-II Analysis
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
