From DrugPedia: A Wikipedia for Drug discovery

Current revision

[edit] General

Rv0084, (MTCY251.02), len: 316 aa. Possible hycD (alternate gene name: hevD), formate hydrogenlyase integral membrane protein, similar to others e.g. HYCD_ECOLI|P16430 formate hydrogenlyase subunit 4 from Escherichia coli (307 aa).Also similar to NUOH_ECOLI|P33603 NADH dehydrogenase I chain H from Escherichia coli (325 aa), FASTA scores: opt: 207, E(): 9.5e-06, (26.5% identity in 260 aa overlap). BELONGS TO THE COMPLEX I SUBUNIT 1 FAMILY; hevD

POSSIBLE MOLECULAR FUNTION

1.LYASE ACTIVITY Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.

2.OXIDOREDUCTASE ACTIVITY Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

[edit] Protein Sequence

>Rv0084, TB.seq 92326:93273 MW:32154

MSYLAGAAQIGGVMVGAPLVIGMTRQVRARWEGRAGAGLLQPWRDLL KQLGKQQITPAGTTIVFAAAPVIVAGTTLLIAAIAPLVATGSPLDPS ADLFAVVGLLFLGTVALTLAGIDTGTSFGGMGASREITIAALVEPTI LLAVFALSIPAGSANLGALVASTIDHPGHVVSLAGVLAFVALVIVIV AETGRLPVDNPATHLELTMVHEAMVLEYAGPRLALVEWAAGMRLTVL LALLANLFLPWGIAGAAPTALDVLTGVVAVAAKVAILAVLLATFEVF LAKLRLFRVPELLAGSFLLALLAVTAANFFTVGA

[edit] Human Homologue Blast Result

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Integral Membrane Protein

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred  
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicted By [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] NHLA Analysis

Link to [5]
Results[6]

[edit] IEDB Analysis

Link to IEDB
Results[7]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Results[8]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Results[9]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.